Conserved Protein Domain Family
PHA02725

?
PHA02725: PHA02725 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165094
View PSSM: PHA02725
Aligned: 2 rows
Threshold Bit Score: 263.391
Threshold Setting Gi: 18640243
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20178388   1 MHVFYAVIDNNIDLECLTLHKGVEYGCKLQLISKNTKTVNIKCIIEVYYSDHLLKPLMAYVNDKLIQLDRKKLRHKIVYS 80 
18640243   1 MHVFYAVIDNTIYLECLTLHKGIEYGCKLQLISKNTKTVNIKYITEVYYSDHLLKPLMAYVNDKLIELVRKKLRHKMVYS 80 
20178388  81 IDLTLYDEVTNMLVCSNMDPDLIDRYYANICLDFDNNVYTVKDKNYTNAVIEYPVVCNFRSYSEsdSDSDVDDRAELHKR 160
18640243  81 IDLTLYDEVTNMLVCSNMDPDLIDRYYANICLDFDNNVYTIKDKNYTNAVIEYPVVCNFRRYSE--SGSDVDDRTELHKH 158
20178388 161 NNDSDSDDYT 170
18640243 159 NNDSDSDDYT 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap