Conserved Protein Domain Family
PHA02724

?
PHA02724: PHA02724 
hydrophobic IMV membrane protein; Provisional
Statistics
?
PSSM-Id: 165093
View PSSM: PHA02724
Aligned: 5 rows
Threshold Bit Score: 58.4457
Threshold Setting Gi: 113195313
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113195313  1 MISNYEPLLLLVITCCVLLFNFTISSKTKIDIIFAVQTIVFIWFIFHFVHSAI 53 
18640366   1 MISNYEPLLLLVITCCVLLFNFTISSKTKIDIIFAVQTIVFIWFIFHFVHSAI 53 
20178509   1 MISNYEPLLLLVITCCVLLFNFTISSKTKIDIIFAVQTIVFIWFIFHFVHSAI 53 
22164723   1 MISNYEPLLLLVITCCVLLFNFTISSKTKIDIIFAVQTIVFIWFIFHFVHSAI 53 
66275931   1 MISNYEPLLLLVITCCVLLFNFTISSKTKIDIIFAVQTIVFIWFIFHFVHSAI 53 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap