Conserved Protein Domain Family
PHA02723

?
PHA02723: PHA02723 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165092
View PSSM: PHA02723
Aligned: 2 rows
Threshold Bit Score: 115.872
Threshold Setting Gi: 18640404
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18640404   1 MDEAYYSGNLESVLGYVSDMHTELASISQLVISKIETINNDILNNNIVNFIMCRSNLNNIYLFPRYCIYYYRSRDLS 77 
113195352  1 MDDAYYSGNLESVLGYVSDMHTELASISQLVIAKIETIDNDILNNDIVNFIMCRSNLNNPFISFLDTVYTIIYQEIY 77 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap