Conserved Protein Domain Family
PHA02718

?
PHA02718: PHA02718 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165090
View PSSM: PHA02718
Aligned: 2 rows
Threshold Bit Score: 108.182
Threshold Setting Gi: 18640259
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18640259   1 MIMSTDPNNILMRYLKNLTDDEFKCIIHRSSDFLYLSDRDYTSITKETLVSEIVEEYPDDCNKILAIIF 69 
113195206 20 MIMSTDPNNILMRHLKNLTDDEFKCIIHRSSDFLYLSDSDYTSITKETLVSEIVEEYPDDCNKNISYYI 88 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap