Conserved Protein Domain Family
PHA02716

?
PHA02716: PHA02716 
CPXV016; CPX019; EVM010; Provisional
Statistics
?
PSSM-Id: 165089
View PSSM: PHA02716
Aligned: 3 rows
Threshold Bit Score: 1003.28
Threshold Setting Gi: 20178387
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20178384   1 MASLTEHAIVNVRKLIYSTCLEDFDNRISTNARINNYDPDDGYCSDGDIYSYNHTVRYKHIKVFKKKYYGID-------- 72 
22164617   1 MASLTEHAIVNVRKLIYSMYFEDFDNRTSTNARINNDDPDDGYCSDGDIYSYNHTVITKRIKVFKKKYYGID-------- 72 
20178387   1 MNSLIENSVLHVRKLLYTIHFNDIDHAPTTATSRDCENQYDSY----DIYVRS---VFKNNLVLERKYYDIVyklinsti 73 
20178384  73 ----NRQRQQYTDSKTALIDIIGSM--ILMLKADRKNKSLVDQYKKFVKyIIK--------------------------- 119
22164617  73 ----NRYREQYTDSKTALINIISNM--ILILKTDRKNKSLVDQYKNFIK-CIK--------------------------- 118
20178387  74 shtiNYDDQTYDNNIKSLLEVTTRFhrHYITSLSRKKKSSIDSIEQMYSqIIKdittelindenvvidvddlclidyddn 153
20178384 120 ---------DNKSKTANHVFDIPNNGDMDILYTYFNSPRTRCIKLDLIKYMVDVGIVNLNYVCKKTGYGILHAYLGNMNV 190
22164617 119 ---------DNKSKTANHVFDIPNNGDMDILYTYFNSPKIRSIELDLIKYMVDVGIVNLNYVCKKTGYGILHAYLGNMDV 189
20178387 154 kddnsdsdsDSDDEDEDSRYENSGKYSSNIFSVYFKAHNTIGIDIKLVKWMIAKG-VDINYK-NEYGSGILHTYLGNMYV 231
20178384 191 DIDILEWLCNNGVDVNLQNSNLITPLHTYMITG-NVCVDVIKKIIELGGDMDMKCVNGMSPIMTYMT-NIDNVNPEITNA 268
22164617 190 DIDILEWLCNNGVNVNLQNRDLITPLHTYTITG-NVCAYVIKKIIELGGDMDMKCVNGMSPIMTYIA-NIDNINPEITNL 267
20178387 232 DTDVLELLCRSGKNINEQNNHLITPLHSYLRRDeSISASVLKKVIELGADRNLRCCMKLTPIMTYIIyNAMNIDEEIIKI 311
20178384 269 YIESLDGDKVKNIPMILHSYITLARNIDISVVYSFLQPGVKLHYKDSAGRTCLHQYILRHNISTNIIKLLHEYGNDVNEP 348
22164617 268 YVESLDGNKVKNIPMMLHSYITLARNIDISVMYSFLQPGVKLHYKDSAGRTCLHQYILRHNISTSIIKLLHEYGNDINEP 347
20178387 312 Y---MDDNKITNIPEILYLYIQMAQYVDIDVVKHFLKNGVILDYKDSVGRTCLHNYMLRTYINIDIVKLLLEHGNYLNEV 388
20178384 349 DNIGNTVLHTYLSMLSVVH---ILDPETDNDIRLDVIQCLLSLGADITAVNCLGYTPLTSYICTAQNYMYYDIIDCLISD 425
22164617 348 DNIGNTVLHTYLSMLSVVN---ILDPETDNDIRLDVIQCLISLGADITAVNCLGYTPLTSYICTAQNYMYYDIIDCLISD 424
20178387 389 DDFGNTVLHTYLSRLCIVNknlTYDSSINNNINIEVVKYLIRSGSDISLVNNLGYTPLTSYICTAQNYMYHDIIDCLMSD 468
20178384 426 KVLNMVKHRILQDLLIRVDDTPCIIHHIIAKYNIPTDLYTDEYEPYDSTDIHDVYHCAIIERYNNAVCETSGMTPLHVSI 505
22164617 425 KVLNMVKNRILQDLLIRVDDTPCILHHIIAKYNIPTDLYTDEYEPYDSTNIHDVYHCAIIERYNNAVCETSGMTPLHVSI 504
20178387 469 KVLNMVKHRIIQDLITRKDISLRIIHHVITKYNIPVDSYTDEYKKCNY-KTNDAYHFRMIKYYNNNILPFSGMTAFHVAV 547
20178384 506 ISHTNANIVMDSFVYLLSIQANINIPTKNGVDPLMLTMENNMLSGHQWYLVKNILDKRPNVDIVISFLDKCYAAGKFPSL 585
22164617 505 ISHTNANIVMDSCVYLLSIQTNINIPTKNGVYPLMLTMGNNTLSGHQWYIVKNILDKRPNVDIVIYFLDKCYATGKFPSL 584
20178387 548 CIRNDVIM-----KYLLSIGYSIDKPTIKGLTALMLIFRRDRYTNC--HIVKMLLDNRPSIDNIIIFLDKCYKNESLFSL 620
20178384 586 LLSEDDIIKPTLRLALMLAGLDYCNKCIEYMERDIAILD--NSHAMFLAFDKLVSIRDNIDKLTKLHINSRSNISIYDIL 663
22164617 585 LLSEDDIIKPTLRLALMLAGLDYCNKCIEYMERDIAILD--NSHAMFLALDKLVSIRDNIDKLTKLHINSRTNISIYDIL 662
20178387 621 CSTKNTNLYGMMALAFMLIGVNNCNKFIERIKHDLETQNttNYRSLSHTLDVLVDIRDNISLLMSTHINNYSTISIYDIL 700
20178384 664 VSKCYKEDIITHRENHNLVACCHGNDPLYDIINKYITDARSMYYIANDISRYIMDMYPVMRIPVPLLFSCIIGIFRLTYF 743
22164617 663 VSKCYKEDIITHRENHNLVACCHGNDPLYDIVNTYITDARSMYYIANDISRYIMDMYPVMCIPVTLLFSCIIGIFRLSYF 742
20178387 701 ISRTYNIDITSCIEICKMYTS--DKYAFYDIINGYIDNAIKTNSIVKDII-YYLRTYPDMCIPTSLLRNCIIDMYDLSGF 777
20178384 744 KKIIIDRHHDSFINARLTDEA 764
22164617 743 KKIIFNRHHAAFINARLTDEA 763
20178387 778 RETL--KRNTSAILPTLNHLN 796
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap