Conserved Protein Domain Family
PHA02715

?
PHA02715: PHA02715 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165088
View PSSM: PHA02715
Aligned: 2 rows
Threshold Bit Score: 337.446
Threshold Setting Gi: 22164615
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20178382   1 MINININTILIFASLFVASFANDYPPPGFFEDKYITNTFNYISIDFELYPVNVSSCNRLSTKQSSDVISTSELTITVNST 80 
22164615   1 MINININTILIFASLFVASFANDYPPPGFFENKYITDTFNYISIDFELYPVNVSSCNRLSTKQSSDIITTSELTITVNST 80 
20178382  81 DCDPVFVTEYYSVKDKTAIAGLFTDTTKKQNTSKMCTLNIEVKCNAETEPVLIGNFTRVPEKASTHAENFTLIGNCLSDL 160
22164615  81 DCDPVFVTEYYSIKDKTAVAGLFTDTTKKQNTSKMCTLNVEVKCNAETEPVLIGNFTRVPETASTHAENFTLIGNCLSDL 160
20178382 161 HLYIAYVNTDEEFEEDTATVHIGNKLDINGIPPNMCATRTIN 202
22164615 161 HLYIVYVNTDEGFEEDTATIHIGNMIDISGIPPNTCATRTIN 202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap