Conserved Protein Domain Family
PHA02714

?
PHA02714: PHA02714 
CD-30-like protein; Provisional
Statistics
?
PSSM-Id: 165087
View PSSM: PHA02714
Aligned: 3 rows
Threshold Bit Score: 136.302
Threshold Setting Gi: 211956443
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22164616    1 MKMNTIFLSAIVTCLVYTSFGKTCPNDYYLEPEDGLCKACVTCLSNMVEIQSCGPDKPRKCQCGPGLKCMLPAVNSCARC 80 
20178383    1 MKMNIIFLSAIVTCLVYTTFGKTCPADYYLEPEDGLCTACVTCLSNMVETQSCGPDKPRKCQCGPGLKCTVPAVNSCARC 80 
211956443   1 --MKYILLITICYSLYCISFASDCEKDYYRDPKTGRCTACVTCTGDTVEKSPCGPTTPRKCECGPGLKCTVSATNTCARC 78 
22164616   81 TPDTTTKKIEpTEQCCTTPDNTKLCYHKYSS 111
20178383   81 TPDTTTKKVQ-KEQCCTTPDNTKLCYHKYSS 110
211956443  79 EEHI-------PDNCCKTKDNTKLCYQKLRG 102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap