Conserved Protein Domain Family
PHA02713

?
PHA02713: PHA02713 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165086
View PSSM: PHA02713
Aligned: 3 rows
Threshold Bit Score: 987.969
Threshold Setting Gi: 22164602
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20178574    1 MDIENDIRNRRIIRNISNLLDDDILCDVIITIRDGEEIKAHKTILAAGSTYFKTMFTTPMIARDLVTRVNLQMFDKDAVK 80 
22164602    1 MDIDDIKHNRRVVSNISSLLDNDILCDVIITIGDGEEIKAHKTILAAGSKYFRTLFTTPMIIRDLVTRVNLQMFDKDAVK 80 
113195392   1 MDFDDIKHYRRVVSNISNLLDDDILCDVIITIGDGEEIKAHKTILAAGSKYFRTLFTTPMIMRDLVTRVNLQMFDKDSVK 80 
20178574   81 NIVQYLYNRHISSMNVIDVLKCADYLLIDDLVADCESYIKDYTNHDTCICMYHKLYEMIHIPIVKYIKRMLMSNIPTLIT 160
22164602   81 NIVQYLYNRHISSMNVIDVLKCADYLLIDDLVTDCESYVKDYTNHDTCIYIYHRLYEMSHIPIVKYVKRMVMRNIPTLIT 160
113195392  81 NIVQYLYNRHISSMNVIDVLKCADYLLIDDLVTDCESYIKDYTNHDTCIYMYHRLYEMVHIPIVKYIKRMLMSNISTLIT 160
20178574  161 TDAFKKTVFEILFDIISTNDNVYLYREGYKVTILLKWLEHNYITEEQLLCILSCIDIQNLDKKSRLLLYSNKTINMYPSC 240
22164602  161 TDAFKNAVFEILLDIISTNDGEYVYREGYKVTILLKWLDYNYITEEQLLCILSCIDIQNLDKKSRLLLYSNTTINMYSSC 240
113195392 161 TDAFKKTVFEILFDILSTNDNVYLYREGYKVTILLKWLEYNYITEEQILCILSCIDIQNLDKKSRLLLYSNKTINMYPSC 240
20178574  241 IQFLIDNKQNRNIIPRQLCLVCHDTKYNVCNPCILVYNINTMEYSVISTIPNHIINYASAIVDNEIIIAGGYNFNNPSLN 320
22164602  241 VKFLLDNKQNRNIIPRQLCLVYHDTNYNISNPCILVYNINTMEYNTIYTIHNNIINYSSAVVDNEIIIAGGYNFNNISLN 320
113195392 241 IQFLLDNKQNRNIIPRQLCLVCHDTKYNVCNPCILVYNINTMEYSVISTIPNHIINYASAIVDNEIIIAGGYNFNNPSLN 320
20178574  321 KVYKINIENKIHVELPPMIKNRCRFSLAVIDDTIYAIGGQNGTNVERTIECYTMGDDKWKLLPDMPIALSSYGMCVLDQY 400
22164602  321 KVYKINIEHRTCVELPPMIKNRCHFSLAVIDDMIYAIGGQNGTIVERSVECYTMGDDTWKMLPDMPDAISSYGMCVFDQY 400
113195392 321 KVYKINIENKIHVELPPMIMNRCRFSLAVIDDTIYAIGGQNGTNVERTIECYTMGDDKWKMLPDMPIALSSYGMCVLDQY 400
20178574  401 IYIIGGSTLYIDYTSVHAVNSIdMEEDTDTSNKVIRYDTVNNIWETLPNFWTGTIKPGVVSHEDDIYVVCDIKDEK--NV 478
22164602  401 IYIIGGRTEHVKYIPVQHMNEI-VDINEHSSDKVIRYDTVNNIWEKLPNLCSGTIRPSVVSHKDDIYVVCDIKDDEinGF 479
113195392 401 IYIIGGRTQHIDYTSVHTINSIdMEEDTNISNKVMRYDTVNNIWETLPNFWTGTINPGVVSHKDDIYVVCDIKDEK--NV 478
20178574  479 KTCIFRYNT-NTYNGWELVTTTESRLSALHTILHDNTIMMLHCYESYMLQDTFNVYTREWNHTCHQHSNSYIMHNILPIY 557
22164602  480 KTCIFRYNTkDNYKGWELITTIDSKLTVLHTILHDDAITILHWYESCMIQDKFNIDTYKWTNICYQRSNSYIVHDTLPIY 559
113195392 479 KTCIFRYNT-NTYNGWELATTTESRLSALHTILHDNTIMMVHCYESYMLQDTFNVYTSEWNHMCHQHSNSYIMHNILPIY 557
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap