Conserved Protein Domain Family
PHA02711

?
PHA02711: PHA02711 
Toll/IL-receptor-like protein; Provisional
Statistics
?
PSSM-Id: 165085
View PSSM: PHA02711
Aligned: 2 rows
Threshold Bit Score: 321.956
Threshold Setting Gi: 20178551
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66275975   1 MDIKIDISISGDKFTVTTRRENEERKKYLPLQKEKTTDVIKPDYLEYDDLLDRDEMFTILEEYFMYRGLLGLRIKYGRLF 80 
20178551   1 MDIKIDISISGDKVTVTTRRENEERKKYLPLQKEKTTDVIKPDYLEYDDLLDRDDMSTILEEYFMYRGLLGLRIKYGRLF 80 
66275975  81 NEIKKFDNDAEEQFGTIEELKQKLRLNSEEGADNFIDYIKVQKQDIVKLTVYDCISMIGLCACVVDVWRNEKLFSRWKYC 160
20178551  81 NEIRKFDNDAEEQFGTIEELKQKLRLNSEEGADNFIDYIKVQKQDIVKLTVYDCISMIGLCACVVDVWRKEKLFSRWKYC 160
66275975 161 LRAIKLFINDHMLDKIKSILQNRLVYVEMS 190
20178551 161 LRAIKLFIDDHMLNKIKSILQNRLVYVEMS 190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap