Conserved Protein Domain Family
PHA02709

?
PHA02709: PHA02709 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165084
Aligned: 2 rows
Threshold Bit Score: 45.9711
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38229283   1 MLYVIISKYIVKLFVDKYFISSKIVVGKFLIYMFISSVNNKTID 44 
157939744  1 MFYLFIIKHLVKLFTDSYFIFSKIVVGKFLIYMFIPSINNEFIK 44 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap