Conserved Protein Domain Family
PHA02708

?
PHA02708: PHA02708 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177484
View PSSM: PHA02708
Aligned: 7 rows
Threshold Bit Score: 103.065
Threshold Setting Gi: 41057438
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289183763   2 HPSLRRLLGALALLALGFALGALF-RPAAPLVPAAFLEVGHVRANGSASVTCLTVGvDERHMAAVADAEGRLLSPVYPAG 80 
41057196    2 HPSLRRLLGALALVAAGFALGALF-RPAAPPLPAAFAEAGPVRANGSASVTCLTVG-DARHMAAVADAEGRLLSPAYPQG 79 
41057438    1 MSALRRLAAAAALVALGLLLGALF-RPAAPALPAAFVEPGPARADGSAELVCLVVG-GAQHMAAV-EAAGAALSPAYPAA 77 
41057067    2 HPSLRRLLGALALVAAGFALGALF-RPAAPPLPAAFAEAGPVRANGSASVTCLTVG-DARHMAAVADAEGRLLSPAYPQG 79 
41057568    1 MSALRRLAAAAALVALGLLLGALF-RPAAPALPAAFVEPGPARADGSAELVCLVVG-GAQHMAAV-EAAGAALSPAYPAA 77 
289183896   2 HPSLRRLLGALALLALGFALGALF-RPAAPLVPAAFLEVGHVRANGSASVTCLTVGvDERHMAAVADAEGRLLSPVYPAG 80 
41057567    1 MASLRRLVASTLFVVFLIALNAMVgNTPQEALPYAHIEVGRADANGSATFTCTIAG--IHHVSNVVIADEQTLSAVYPRS 78 
289183763  81 EGMHARFSSLRRGALLLNVATVTVYDVRGLRDDFELTCIAVVGGFNSATAAARPAVEWRRQLERMR-RAEL 150
41057196   80 EGMHASFSSARKGALLLHVATVTVYDVRGLRDDFELTCVAVVGGYNSATAAARPRSEWLRQLERLR-RAEL 149
41057438   78 AGVRASFASARKGPLLLQEVTVAVQDVAALDADAEFACVAFAGGFRAAAAYARPVAEWRRQLERLR-REEL 147
41057067   80 EGMHASFSSARKGALLLHVATVTVYDVRGLRDDFELTCVAVVGGYNSATAAARPRSEWLRQLERLR-RAEL 149
41057568   78 AGVRASFASARKGPLLLQEVTVAVQDVAALDADAEFACVAFAGGFRAAAAYARPVAEWRRQLERLR-REEL 147
289183896  81 EGMHARFSSLRRGALLLNVATVTVYDVRGLRDDFELTCIAVVGGFNSATAAARPAVEWRRQLERMR-RAEL 150
41057567   79 DDASAEFNYRRRGLVHVHLVVVTVHDVSRLHTDDWIGCQAITGAFVASSAYAAPVAAWMQEIRALReHIEL 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap