Conserved Protein Domain Family
PHA02707

?
PHA02707: PHA02707 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165082
View PSSM: PHA02707
Aligned: 2 rows
Threshold Bit Score: 49.2097
Threshold Setting Gi: 119223233
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20178575   1 MLNFSLCLCSVFILDKLVFRTQSIILHTINNASIKKS 37 
119223233  1 MLNFSLCLYPVFILNKLVLRTQSIILHTINNASIKNR 37 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap