Conserved Protein Domain Family
PHA02706

?
PHA02706: PHA02706 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165081
View PSSM: PHA02706
Aligned: 2 rows
Threshold Bit Score: 75.7852
Threshold Setting Gi: 157939650
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38229191   1 MQFENTLLVIAIIMMLLGVASMIVDTVIFINSYFVKKrKCINKNDETKPLLNKTMYEK 58 
157939650  1 MQLESTLLVIAIIMMLLGIGSIIIETVVFINAYFVKK-SYKYKKNEIEPLLDKTKYEK 57 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap