Conserved Protein Domain Family
PHA02705

?
PHA02705: PHA02705 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165080
View PSSM: PHA02705
Aligned: 4 rows
Threshold Bit Score: 94.364
Threshold Setting Gi: 20178565
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66275990   1 MDTDVTNVEDIINEIDREKEEILKNVEIENNKNINKNHPSGYIREALVINTSSNSDSIDKEVIECICHDVGI 72 
22164594  16 TDTDVTNVEDIMNEIDREKEEILKNVEMENNKNINKNHPSKYIREALVINTSSNSDSIDKEVIECISQDVGI 87 
20178565  19 SDTNTANVEDIMNEIDREKEEILKNVEMENNKNIKKNHPSEYIREALVINTSSDSDSIDKEVIECISQNVGI 90 
113195375  7 TDTDVANIENIMNEIDREKEKILKNVEMENNKNINKNHPSKYIREALVINTSSNSDSIDKEVIECISQDIGM 78 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap