Conserved Protein Domain Family
PHA02703

?
PHA02703: PHA02703 
ORF007 dUTPase; Provisional
Statistics
?
PSSM-Id: 165079
View PSSM: PHA02703
Aligned: 2 rows
Threshold Bit Score: 320.392
Threshold Setting Gi: 41057443
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057070   5 HTSLAMEFCCtETLRVVRLSQNATIPTRGSPGAAGLDLCSAYDCVVPSHCSCVVFTDLLIKLPPGCYGRIAPRSGLAVKH 84 
41057443   1 MEFVENHFAC-DALRVVRLSPNATLPTRGSPRAAGYDLCSACDCIVPAGGRRVVFTDLQIQLPDGCYGRVAPRSGLAVKH 79 
41057070  85 FIDVGAGVIDEDYRGNVGVVLFNFGNSDFEVKKGDRIAQLICERISHPAVQEVNRLDDTDRGDSGFGSTGSGAcGGSGDT 164
41057443  80 FIDVGAGVIDADYRGNVGVVLFNFGHNDFEVKTGDRIAQLICERAAFPDVEEVACLDDTERGAGGFGSTGVRT-ERCRTT 158
41057070 165 VWYIS 169
41057443 159 VWYVN 163
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap