Conserved Protein Domain Family
PHA02702

?
PHA02702: PHA02702 
ORF033 IMV membrane protein; Provisional
Statistics
?
PSSM-Id: 177483
View PSSM: PHA02702
Aligned: 3 rows
Threshold Bit Score: 113.091
Threshold Setting Gi: 41057469
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057469   1 MNNRDLGTAVGATLLMLVIVVLGGATVLRRGSASLGIRSRGALRVLTVMDFLAMLTTIPCTIILYFLCMQQLwrasGKRT 80 
41057096   1 MESRDLGVAVGATILMLLIVVTNGATIARRGAPSLGIRSRGALRVLTVLDFVSLLTTIPCTIILYFLYMQAL----NSRR 76 
289183797  1 MESRDLGVAVGATILMLLVVVTSGATIARRGAPSLGIRSRGALRVLTVLDFVSLLTTIPCTIILYFLCMQAL----NSRQ 76 
41057469  81 EN 82 
41057096  77 QN 78 
289183797 77 KN 78 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap