Conserved Protein Domain Family
PHA02701

?
PHA02701: PHA02701 
ORF020 dsRNA-binding PKR inhibitor; Provisional
Statistics
?
PSSM-Id: 177482
View PSSM: PHA02701
Aligned: 3 rows
Threshold Bit Score: 320.356
Threshold Setting Gi: 41057456
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057456    2 ASCDRESKILTFLSSSGTPVPAKRVAAALGISKHDANRCLYKLLESDAVSCVDGCPPLWSAPCEADEKKDTasgddeatg 81 
41057083    1 MACECASLILELLRKSDDKLPAKQIAKELGISKHEANRQLYRMLELDDVCCEDGNPPRWFVECAPSAPTEE--------- 71 
289183784   1 MSSDCASLILDLLKTCGDKLPAKNIAKELGISKHEANRHLYRLLDKDEVRVEEGHPPHWYVECEPATSVEE--------- 71 
41057456   82 GSGSDPEPMETECTYlgASLFGEDIDVLTVGAVTHLKTLNPVSAVNEYCMRVHRPLVFQECRTGGHDHCPLFTCTVVVSN 161
41057083   72 DENSDTEPMETEAGC--DTLFGGDIDIMTQSAVMRLKSLNPVSAVNEFCMMTHRSLEFCETRSGGKDHCPLFTCTITISG 149
289183784  72 ---DDTEPMETEAGC--DTIFGGDIDVLTKSCVMRLKTLNPVSAVNEFCMITHRTLEFCETRSGGQDHCPNFTCTIVVSG 146
41057456  162 KTVSTASGCSKKAARNAACTDALTILINNCGVSF 195
41057083  150 KVVAAADGASKKLARHTACASALTILINNCGISF 183
289183784 147 KVIATATGTSKKLARHAACATALIILIDNCGISF 180
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap