Conserved Protein Domain Family
PHA02700

?
PHA02700: PHA02700 
ORF017 DNA-binding phosphoprotein; Provisional
Statistics
?
PSSM-Id: 177481
View PSSM: PHA02700
Aligned: 3 rows
Threshold Bit Score: 170.918
Threshold Setting Gi: 289183781
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289183781   1 MENGKvIQKKPFIIHVDGVGRVLVLKYVRMCDVTEAKCEGSRASCVLKIDPPRSPSCERRPqLPPTPPCPMRSPPGSPLR 80 
41057453    1 MEAGG-VHKRPFIVNVEGQGRVLVLRYVKLCEVPEARCEAPRTSCVLKVDPPKSPVCDRRP-VPLSPTACVRTPPGSPGA 78 
41057080    1 MDGG--VHKRPFIVNVEGMGRVLVLRYVRMCEVPEAKCEGSRASCVLKMDPPRSPGCERRPpLPPSPPCPVRTPPGSPLQ 78 
289183781  81 APLMQTQLLQGLFETAKTNGEQMvCRRQ 108
41057453   79 TPFMPTNMLESLFTRAKTNGEQA-CRRQ 105
41057080   79 APLMRTQMLQGLFDTAKNNGEQM-CRRQ 105
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap