Conserved Protein Domain Family
PHA02699

?
PHA02699: PHA02699 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165075
View PSSM: PHA02699
Aligned: 2 rows
Threshold Bit Score: 894.753
Threshold Setting Gi: 41057072
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057445   1 MTWCGLARMSSFTSLFRRLSYGRSSCVPRTGCMPMRRPRIRSNDEDSeyDDNVPYGGDPDSVDAAAPV-ARPLVLTVPGA 79 
41057072   4 WLWCGRPRMSALARLFGRFGRGRNQCVPTAGCMPLRRPRDGADGGDS--DDDYEYGDTDSVASSVAPVeARPLVLTVPGT 81 
41057445  80 SRPVLVDSVFERIIPDVSALVTHLGEWTEIRLFESPFHRAPVRVCRSVLARYIYDAEAMFEVKDCQALKLRHGEWYMRQK 159
41057072  82 NCPVLVDSVFETRIENTSSVVTHVGDWSSISLFESTFHRAPARICRSEFSRYVRDANMHFEVGESYGLKLKHDEWYMRHH 161
41057445 160 VSPDMASFVALICIRNEGVAALAVNNTKYLNTNITVGSAIVFPAVRGMFLLPHIGGEAEYIILTMTPTQDLLDQGYDVFS 239
41057072 162 MAPTVAAYVAILCVKNEGMAGISVNNTKFLKTNMQEGDVLVVPAARSMFFLPQVGGDAEYIIVTLVPTAELRDLGFEVFP 241
41057445 240 PSVDQDAQIRTASAAETRKRACVLVSDLITLRIELEECYHRICKLMIVISEFGDLYSNVGAKMITESVDAIAKGMGSvdv 319
41057072 242 PSIDQEAQVLVANVAETRRKACKIVNRIVKLRVDLEKCYYEICKLVIMITEFNERYNDVGAQMITASVDAIARGMGG--- 318
41057445 320 ggencevdgvASAVALCRRasSRSRRRPVSVSMNRSHSLLNIGLNNLFAMFAQCANGTPHPDSLMARMEKDLQDMYARFT 399
41057072 319 ----------AAQTALCRQ--SLRGRRPLSAALTRNHSILEHGITGLFAVFAQTPEGTPHPDSLMARMERDLRELYSRFS 386
41057445 400 ELWDTVLEKAADLDSTLPRTEVLEKFIHLQVCNSPAGIERNQLVQRLTMLAGSGYRLTGSGEGVPV 465
41057072 387 ELWDDILQLASDLDSTLPRCECIERYIHHMVCVSEAGVKRNELVQRLTMIAGAGYRLTGSGEGVPV 452
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap