Conserved Protein Domain Family
PHA02695

?
PHA02695: PHA02695 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177477
View PSSM: PHA02695
Aligned: 3 rows
Threshold Bit Score: 1458.3
Threshold Setting Gi: 289183783
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057082    1 MLQLLKRFVGAAVAAGGTERAFAALSTSEAMELVLAGVHPRHLPRRLYARVVAEHPTHLHLFRPQHVTPEDLLEELSRRR 80 
41057455    1 MLHNVKSFVASAAACGSVERAFADLSVEDALSLMADGIHPKHLPRKMYAPVSERFQTYLHLFRPQHVLPEDLLEELSRRR 80 
289183783   1 MTQLLKSFVGAAVAAGGAERAFAALPTSEAMDLMLTGVHPKYLPRRLYATVAAEHPTHLHLFRPQHVTPEDLLEELSRRR 80 
41057082   81 CGALFARHIEFHTPYIVQFADYALLCRCIPYMNITEDDVRLIEERFPDNVDDIILHVNARSVHNINAAFTDEMIEDIVEA 160
41057455   81 CGALFAEHIAYHTPYLVQHADYALLCRCIPFMDITEDDVRLIEERFPDDVDDVLVNVNARSVHNINAVFTDEMMEAIVEA 160
289183783  81 CGALFARHIEFHTPYLAQFADYALLCRCVPYMNITEDDVRLIEERFPEEVDNILLHVNARSVHNINAAFTDEMMEDIVEA 160
41057082  161 RPEMASALYTTRPLDLCFLKRMLAEHRIPPVNSGLAAATPADAVEMLAQMRGVYDVRRTLDGLRHSVLCSETMKAFALER 240
41057455  161 RPQMAPALYATRPLDIGFLKRMLCDHGIPPVNAGLEAASPLDAVEILARLTAVYDVRRVLDGLRHSVLSSETVKAFAIER 240
289183783 161 RPEMASALYTTRPLDLGFLKRMLAKHRIPPANPGLAAATPADAVEMLAQMRGVYDVRRTLDGLRHSVLCSETVKNFALER 240
41057082  241 IRAGQVREYLHYARDYLRDRVSDTGAFGPIFVDAATYLNVDNLSHVELSVIADFPGKFDAEFVWRKALEGGFGDVLGKLL 320
41057455  241 IRQGEVQAYRHYAEDYLRDRVSDIGAFGPIFVEAATYLNMDALSHAELLAIADFPNKFDATFMWNTALAKGYHDVLAKLI 320
289183783 241 IRAGQVQEYLHYAKDYLRDRVSDTAAFGPIFVDAATYLNVDNLSHAELSAIADFPGKFDTGFVWRKALEGGFGDVLGKLL 320
41057082  321 RAMPVDAVTEDVCVSVVESGHRVPVTDMCVHTRRVAEACVRQNFPDVVDFLDTVPLSTLLAVGADPFASDYVFSTSWIND 400
41057455  321 RLADVDAVTDDVCVGIVESGHPVAVADMCVHTTRVAEACVRQKLPDIVDLLDTVPLRALLKMGADPFASDYVFRTAWFND 400
289183783 321 RTVSVDEVTEDVCVAIVESGHRVAVTDMCVHTPRVAEACVRQNFPDVVDFLDTVSLKTLLAVGADPFATDYVFSTSWIND 400
41057082  401 RPELAEEYVRRFAFSGSRMTRLLFGYALKPNALKRVHDALCATEVLAPAARESLGCLVSEGEMRLRSVDDVRRPRECEDP 480
41057455  401 RPELAEEYTRRFSFSGERMSRLLFGYALKPATLQRVYDTLRSEDAVSPAVRESLGFLVSAGDMRLKPNHEVRRPREVDDL 480
289183783 401 RPELAEEYVRRFAFSGPRMARLLFGYALKPHALKRVHDALCAEEVLAPAVRESLGCLVSEGEMRLRSVADVRRPRECEEP 480
41057082  481 EEGYEQEIFSSEHSARLAVCLTAYAVPGLRGYATADLAITRHASGNVILQALRVNRADSAVNKVVDHAFDIARMASYGLF 560
41057455  481 EEGYEQEVFSSEHSARLAACLSVYSLPGLRGYATADLAITHHPSGNVILQILRAHKSDNAVNKVVDHIFDVARMARYGLF 560
289183783 481 EEGYEQEIFSSEHSARLAVCLTAYAVPGLRGYATADLAITRHASGNVILQALRVSRADSAVNKVVDHTFDIARMASYGLF 560
41057082  561 LIPDMFTPGWTPVLDLARGLPAGPPPVLKMERLSFSPSELVQYRGIGRFALGCETAVGPCSDHQMAMDALFRCLFVHIAM 640
41057455  561 LLPDMFTPGWTPVLDMARGLPASPPPVLKAERLSFSPSEMVEYRGIGRFSLGYESATGPCSDHQMAMDALFRCLFVHIAL 640
289183783 561 LIPDMFTPGWTPVLDLARGLPARPPHVLKMERLSFSPSELVQYRGIGRFALGCETAVGPCSDHQMAMDALFRCLFVHIAM 640
41057082  641 GVRLVEQVDVVVLVRQIVNAFTDGLCAERFVEPVDFVEQELMELRAWAPDARTIESSRVCMRNTTLLCQQVCARLALYNN 720
41057455  641 GVRLTEQVDVTVLARQVINAFTDGLCTERYTDTVEFVEQELVELRAWGPNERTIESSKVCMRNTTLLCQRVCAQFAMYNN 720
289183783 641 GVRLVEQVDVVVLVRQIVNAFTDGLCAERFVEPVGFVEQELTELRAWGPNERVIESSKVCMRNTTLLCQQVCARLALYNN 720
41057082  721 RGFRK 725
41057455  721 RVFKK 725
289183783 721 RAFRK 725
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap