Conserved Protein Domain Family
PHA02694

?
PHA02694: PHA02694 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177476
View PSSM: PHA02694
Aligned: 2 rows
Threshold Bit Score: 481.934
Threshold Setting Gi: 289183788
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057087    1 MASYVSGASASANTAQGGNSQypqyysHTRTSQGDVRDESENRLHitddehlvlsddclgngasycGHSHNHAHNHSRRG 80 
289183788   2 SDGYLSDDTRYLNHSHGHTPR------HNHGHEGHRHGPTNSHIH---------------------SHDYGHEGHGHEGH 54 
41057087   81 GDRHRQRAPRLYEDPVPANIMVPTLSLEQLLEETSVAGGLLGGNAEKDVEQLLEEFSALCPGDQITALRCMAASFYRDAL 160
289183788  55 GHRESRRAPRLYEDPVPANIIVPTLSLEQLLEESSVAEGLIGGRSEQSVEQLLEEFSALCPGDQITALRCMAASFYRDML 134
41057087  161 FAPYACMHLIASRMRVHYAREVVHVAEDLADAMSATSGVCFRRYRKRVLEDMLAEEMSVYTYLARANADICEDNLLSAVE 240
289183788 135 FAPYACMHLIATRMRVHYAREVVHVAEDLVDAMSADSGVCFLRYRKRVLEDMLAEEMGVYRYLTGANADVCEENLLSAVE 214
41057087  241 TLLRRFRRMGCYRSLCMLKILALQHEDLAGFIRRSIRKTCNFAHARTHTVYV 292
289183788 215 TLLRRFRRMGCYRSLCMLKILALQHEDLALFIRNGIRKTCNFAHTRTHTTFV 266
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap