Conserved Protein Domain Family
PHA02693

?
PHA02693: PHA02693 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177475
View PSSM: PHA02693
Aligned: 3 rows
Threshold Bit Score: 1353.92
Threshold Setting Gi: 41057464
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289183792   1 MLLYPKKARDAAAALAKKNFCAEKLSRAQLLSLLPCGLHGDLPMSVYDEAVAASPTNVMFFPPQHVKLPDLIDALKSTRA 80 
41057091    1 MLLYPKKARDAAAALAKKNFCAEKLSRAQLLSLLPCGLHGDLPMSVYDEAVAASPTNVMFFQPQHVRLPDLITALKSTRG 80 
41057464    1 MLLYPRKARDAAASLAKKSFCAEKLSRSQLQCLLAHGLHGELPESVYEEAVAACPLNVMYFPPHTVKLTDLITALKTVKT 80 
289183792  81 ICKKMMPAVCFHKRALLGADDMEVLKSLLRAGLVYEPEVVSMVAKGRLPAVLALTCAPWTACTQLKLSRTEIETVCRAID 160
41057091   81 ICKKMMPAVCFHRRALLAADDIEVLEALLKAGLVYEPEVVAMVGKGRVSAVFALTCAPWTACAQLKLSRTEVETVCHAID 160
41057464   81 VPKKMTPVVILNKRQLLAARDMDVLRVLLSAGLVYEPEVVDLVEKGEVPAVLALTCAPWTACPRLRLTRTEIETVCRAID 160
289183792 161 PALVNEMIPKLEIAPEDLVALADNGNIPPLNSALRHVDDVATCARLVCEWPYFNILKFLNPNMVASREFVQAVREGAMAL 240
41057091  161 PALVNDMIPKLEISPEDLVALADGSNIPPLNRALRSVDDVATCARLVCEWPYFNIIKFLDPNMVASREFAQAVREGAMAL 240
41057464  161 PSNVNEMIPKLKISPQDLVALADKGNIPPLNRALCELEDACTCARLVCEWPYFNIMKFLSVDMVRSKEFARAVREGAAAL 240
289183792 241 CVRPVGADRMVGISKSRSRRLPEEHVDIHYGETDTADSCaSRSFSTQSMRSTRSTRSTRSTRSSapsthsahsthsdDTE 320
41057091  241 CVRPVGADRMVGISKSRSRRLPEEHVDFHYEEADTADSC-SRSFSTQSTRSARSSAPSTRSAET-------------DTT 306
41057464  241 CVRPVGADNLVGISKSQSRRLPEEHVDFHYDESDTTDSC-SNTWSTRSTHSTRSTRSTRSG------------------- 300
289183792 321 PADPDPDPDESRDDVGQLTRRFTVTSFHPRTSLRSSSASMRLHARGSCRISEPLMSSAARVPKVSIAPTLDTAEELMWHL 400
41057091  307 DPDLDPDLDESQDEVGPLTRRFTMTSFCQRPSMRSSSASMRLHARGSFRASEPLMRSAARVPKASVSPTLDTAEELMWHL 386
41057464  301 ----DSPDSESFEEPGPLVRRNTARACAPRASVRSSAASIRRH-RGSTRISEPVISSEGRVPKVVMASASDTAEELLCHL 375
289183792 401 SEEWRKGRHAKTATLDRLLQDFRLNATFPRTMLASEVPNELKRKMLKVVCGWQVSGEPETAATAAIEGSTEQIMALLLTE 480
41057091  387 GEEWRKGRHAKTATLEKLLQDFRLNATFPRTMLASEAPNELKRKMLKVVCGWQVTGEPSSAATAAIEGSTDSIMALLITE 466
41057464  376 SSEWVHGRRAKTAVLEKLLEDFRLNLAFPRLVLCSDAPNELKKKILKVICNWHTVGDPTSAATAAVEGTTDQILGLLLTD 455
289183792 481 HTHLGGLIELLSKPPLPPCCGCEFCARHTAPGTSSLRSASFaAGATPARELDDTAILAAVADVTLLAMHGVVDPCFAGSV 560
41057091  467 HGHVGGLISLLSKPPLPPGCGCEFCARHTAPDRSALRSASL-TGATPSNELNDAAILAAVFDVTLLAMHGVVDPCFAGSV 545
41057464  456 YRHVSGVMTLLSKPPLPPSCGCEFCDRQATPGRAALRSASFgTGAAASPELDDAALRTAVADMVLLALHGVVDPCFAGSA 535
289183792 561 CWGPLSCALSGARHMDAQRLVEALDYEKLIFANISSDGVKDTNVLMRLSLLKISDFVPDAHVLSTRHAQALIAVGCVAEY 640
41057091  546 CWGPLSCALSGARHMDAQRVVEALDYEKLIFANISCDGVKDTNALVRISRLKISDFVPDAHVLNTRHAQALIAVGCVAEY 625
41057464  536 AWGPLSCALAGARLMDEARLVEALEYEKLIFANLSADGVKNTNNLLRLSRVKASDFVAEASILNTDHSRALIAVGCIAEY 615
289183792 641 LLAAIFFRVTVLRRMSKIREFVAKVVSVAMEATGTTAPSIKVHDRVETEVRECSESGE-VPFCTVGLVLRTVLAILETLL 719
41057091  626 LLAAVFFRVTVLRRMSKIREFVAKVVSVAMEATGTTAPSIKVHDRVETEIRECSESGE-VPFCTIGLVLRTVLAILESLL 704
41057464  616 MLAAIFFRVVVLRRMSKIREFVAQIIAAAMDATGTVAPPIKVHDRVEKEVRDFAEVGAgVPFCTVGLVLRTVLTILEELV 695
289183792 720 GDGGN 724
41057091  705 GDGGD 709
41057464  696 HHGSD 700
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap