Conserved Protein Domain Family
PHA02691

?
PHA02691: PHA02691 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177473
View PSSM: PHA02691
Aligned: 3 rows
Threshold Bit Score: 182.517
Threshold Setting Gi: 41057101
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057474    1 MTWAvLEVALFVGFLALMYALNVLPTNKMQLAVRELADDRLYRQRLDAQLDAVSESVLFQTPDAPRASAVLVSMDSRNER 80 
41057101    1 MSWA-VEFVLFAAFLAAAYVFTFLPTNKMQLAVRELADARAWRQRTDAQLDGISETVLFPRPDAPQGSAVIASIDARRAR 79 
289183802   1 MSWA-LELALFAAFLAAAYVLTFLPTNKMQLAVRELTDARAWRQRTDAQLDGLSESVLFPRPDAPQGSAVIAELDSRRAR 79 
41057474   81 VTVAHGRDKSVFDLKRRGDVQTLIPILLLSK 111
41057101   80 VTVAHGREKSTFDLKRRGDVQTLLPILLLSK 110
289183802  80 VTVAHGREKSTFDLKRRGDVQTLLPILLLGK 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap