Conserved Protein Domain Family
PHA02689

?
PHA02689: PHA02689 
ORF051 putative membrane protein; Provisional
Statistics
?
PSSM-Id: 177471
View PSSM: PHA02689
Aligned: 3 rows
Threshold Bit Score: 192.843
Threshold Setting Gi: 41057487
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057114    1 MAAPTTPVVHLTPVFVEPTIAHSLLRAESYLAIAVLELVLALALALVFFRDELGALFRRAPRAPSPLDAYLQASLVCDGD 80 
41057487    2 ATDKAAPVVNLTPVFVEPTIAHSLLRSEPYLTLVVLELLLALALTYLFFGDELRSALRGRQRPPSPLDAYGEASLACDGD 81 
289183815   1 -MAVPTPVVHLTPVFVEPTIAHSLLRAESYLAIAVVELLLALALALVFFRDELGALFRRAPRAPSPLDAYLQASLVCEGD 79 
41057114   81 ALLIELPEGRVPALALDGRPVAFPGCESLLYRINGPRKVRLVDVLGGR 128
41057487   82 ALMIELPGGRLPALALDGRPVAFPGCDGVLRRINGTRKVRLVDVLGRG 129
289183815  80 ALMLELPEGRLPALALDGRPIAFPGCAGLLHRINGPRKVRLVDVLGGR 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap