Conserved Protein Domain Family
PHA02686

?
PHA02686: PHA02686 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177468
View PSSM: PHA02686
Aligned: 3 rows
Threshold Bit Score: 214.83
Threshold Setting Gi: 41057126
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057499    1 MDKSLAVAVRLVEGLSPLDVAVCLCHLRAEQPARRFPAIDEASGEAFLDFEFADGDVASRYLPMCARELAPDERKAHMSA 80 
41057126    1 MDEALRVAARVVDGLRPLDVAVCLVQLRGAAPERRFPALDERSGEAFLDFEFAGGDVASRYLSAHTRELCAAERREHMAA 80 
289183827   1 MDEALRVAARVVDGLSPLDVAVCLAQLRGGAPERRFPALDEGSGEAFLDFEFAGGDVASRYLSVRTRELCAAERREHMAA 80 
41057499   81 IACRLTEADLALAAGPRGKARAVIRVCKNKKKVHRLLRLIKESEDRDVDFSFIRDAVL 138
41057126   81 IARCVTEADLALADRPRGKARAALRVCRNREKVSRLARLLRDAESSGADFAFIRAAVV 138
289183827  81 IARCVTEADLALAGRPKGKARAALRLCRNREKVARLARLLRDAESRGADFAFIRAAVL 138
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap