Conserved Protein Domain Family
PHA02685

?
PHA02685: PHA02685 
ORF065 virion protein; Provisional
Statistics
?
PSSM-Id: 177467
View PSSM: PHA02685
Aligned: 3 rows
Threshold Bit Score: 263.017
Threshold Setting Gi: 289183829
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289183829   1 MEPAMHGDLHALKSLVALAPSLDRVGAALA-WPHVLVERDHRGAPARVHRFDRALRLDNRAALRAAKAVFGHRARMMRAL 79 
41057128    2 EPSAMREDLHALKSLVALAPSLDRVGAALA-WRHVLVERDHRGAPARVHRFDRALRLDNRSALRAVKAVFGHRSRMMRAL 80 
41057501    3 SRVPIGGDLQNLKSLVAHAPTLDRVSAAVAgWRHVLVERDHRGTPVRLHRFEHALRLDNLTALQAVKAVFGHRKRMMRAL 82 
289183829  80 FPNRAFFEALEPLPPAETLVLRATREPPPDDGSPIDARETAAWLAELFNAFRAGTGAGAasAPWFCLPLAEDVQHVNL 157
41057128   81 FPSRAVFEALEPLPPAETLVLRAAREPPPDDGGPIDARETAAWLAELFNAFRAGAGAES--TPWFCLPLAEDVQHVDL 156
41057501   83 FPSEAIFDSLEPLQPAETLELRAAPPVPEDDGSEIDAQETAWWLTELFNAFRAGGGSGA--APTYCLPLAEDVKHVAL 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap