Conserved Protein Domain Family
PHA02684

?
PHA02684: PHA02684 
ORF066 virion protein; Provisional
Statistics
?
PSSM-Id: 177466
View PSSM: PHA02684
Aligned: 2 rows
Threshold Bit Score: 285.84
Threshold Setting Gi: 41057129
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289183830   1 MAGSIYYCGGTHLVAAAPGAALVVLDAPGPVAAAAPAGPRVFFAEYGLEKRPGAPVTARLRKSGFRSAAGAWASAADFEA 80 
41057129   72 ADGSIYYCGGTHVVAAAPGAALVLLDALGAVAAAAPAGQRVFFAEYGLEKRAGGPITARLRRSGFRGAANAWASVADFEA 151
289183830  81 GGRPVAWTLRAEEAARVPLPADAALVLAWGARAEPLRVCVLARAEDAEAPVGAALKEAAFDARAPAAALMAALGEPALAL 160
41057129  152 GGRPSAWTLRAEEASRVPLPTDAALVLAWGARDEPLRACVLARAADAEAPVGAALKEAAFDARAPAAALFAALGAPALAP 231
289183830 161 PLKARLVTPPGAPPRSRLCANPDMLRAFAAGWFGAQLGaDDSENEKVFVAFDRARSCLDDR 221
41057129  232 PLRARLVAPPGAPPRTRLCENPAMLRAFAVGWFGAQLG-EASENEKVFAAFDKARSCLDDR 291
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap