Conserved Protein Domain Family
PHA02683

?
PHA02683: PHA02683 
ORF078 thioredoxin-like protein; Provisional
Statistics
?
PSSM-Id: 177465
View PSSM: PHA02683
Aligned: 18 rows
Threshold Bit Score: 103.65
Threshold Setting Gi: 9629037
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17975026   1 MSWYEKYNIVLNPPKRCsSTCSDNLTTILSEDGTNiIRAILYSQPKKLKILQDFLTTSRNKMFLYKILDDEIRRVLT 77 
41057141   5 DVWFAAYSVELDPPRRC-TRCSLNLTRFINEDPEN-ARMLLLSQPGRARALAGFLQFCRTRTLDTKVLDREILRVLG 79 
41057514   6 ASWYAAYSVTLDPPRRC-TRCSLNLTRFVNEDRDN-AMLLIASQPNRARILGEFLVFCRNKSMDTKVLDREIRRVLL 80 
289183843  5 GAWFAAYSVDLDPPRRC-TRCSLNLTRFINEDPDN-ARMLLLSQPERARVLAAFLQFCRTRTLDTKVLDREILRVLG 79 
18640353   1 MSWYEKYNIVLNPPKKCfSSCADNLTTILAEDGNN-IRAILYSQPQKLKVLQDFLATSRNKMFLYKILDDEIRRVLT 76 
20178496   1 MSWYEKYNIVLNPPKRCsSACADNLTTMLAEDGNN-IRAILYSQPQKLKVLQDFLATSRNKMFLYKILDDEIRRVLT 76 
22164710   1 MSWYEKYNIVLNPPKRCsSACADNLTTILAEDCNN-IRAILYSQPQKLKVLQDFLATSRNKMFLYKILDDEIRRVLT 76 
12085076   1 MSWYSKYNIVLDKPKKC-SKCFSNLFEYIIQDKET-MKIMLESQPEKMQTLKKFLSTTRNKHFTYKILDEEVRRVLT 75 
38229255   1 MSWHLKYNVVLDEPKKC-SKCFSNLFEYIVQDSET-MKIMLEDQPKKLQTLKRFLSATRNKHFTYKILDEEIRRVLT 75 
113195300  1 MSWYEKYNIVLNPPKRCfSSCADNLTTILAEDGNN-IRAILYSQPQKLKVLQDFLATSRNKMFLYKILDDEIRRVLT 76 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap