Conserved Protein Domain Family
PHA02682

?
PHA02682: PHA02682 
ORF080 virion core protein; Provisional
Statistics
?
PSSM-Id: 177464
View PSSM: PHA02682
Aligned: 2 rows
Threshold Bit Score: 296.387
Threshold Setting Gi: 41057143
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057143    1 MDLRRRFASDLAKTKLVLSETSSSLFTKCPQAVIPTPEQPCPPDEEVDSVDKYTVKEAGRYYQSRLKSTTACMQRPTGQS 80 
289183845   1 MDLRRRFAEDLAQTKLVLADTSSSLFTKCPQVTIPAPAAPCPPDADVDPLEKYSVKEVSRYYQSRLKANSECMRRPSGQS 80 
41057143   81 PLAPSplprgariqsvplnvmpaacstpvaacsatavvcppaapacpapapacpapvPACPAPAPACPAPAPACPAPAvT 160
289183845  81 PLAPT----------------------------------------------------PPCAAPRTQTPSCAPPAVCPA-T 107
41057143  161 CPAPAPACPPAtapTCPPpavcpaparpaPACPPSTrqCPPAPPLPT-KPAPAAKPIFLQQSLPPPQYPASSCPTIK-AP 238
289183845 108 CPAPAPACPPA---TCPP-----------SACPPST--CPPAPPLPTpKPLPAARPSLYHNQVSPPDYPAASCPTIEtAP 171
41057143  239 AASPVLEPRVPDKIIDAdNDDKDLIKKELADIADSVRDLNAESLSLTRDIETAKSVTQSAIDDLRRLL--GSVATRETPS 316
289183845 172 AASPVLESRIPDKVLEG-SSTKDTIQKELADIADSVRDLSAESTSLTRDIENAKSTTQAAIEDLRRLLtgTGVSRSDTPS 250
41057143  317 TLRDRVDNTGTS 328
289183845 251 ALRDRVDNTGTS 262
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap