Conserved Protein Domain Family
PHA02679

?
PHA02679: PHA02679 
ORF091 IMV membrane protein; Provisional
Statistics
?
PSSM-Id: 177461
View PSSM: PHA02679
Aligned: 3 rows
Threshold Bit Score: 71.1636
Threshold Setting Gi: 289183856
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057527   1 MVSDYDPAVLVLIFCAAMAANVYMTPQTKLSTIFVLQSVVFSWFLFHFVHSVI 53 
41057154   1 MVSDYDPAVLVFIFCMALAANFCMPMKTKLSTIFVLQSVVFSWFLFHFVHSVI 53 
289183856  1 MVSDYDPAVLVLIFCVALAANFYMPTRTKISTIFVLQFVVFSWFLFHFVHSVI 53 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap