Conserved Protein Domain Family
PHA02678

?
PHA02678: PHA02678 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177460
View PSSM: PHA02678
Aligned: 3 rows
Threshold Bit Score: 136.277
Threshold Setting Gi: 41057155
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057155   1 MFLDSDTVVVAVPGTSFPEGLFDRQGRPLRPGSTPTMSYEDPVPRTARALLLVNPTAGQLAAVAAGAPAGVRVLVLVDVA 80 
41057528   1 MFIDDNTVIVLNSGERFPEALFDTRGRPLGPRSVRTMEYDASVPRDARALLLVNPTAGQLAVVAAGAPAGARVLVLVDAE 80 
289183857  1 MFLDSDTVIVAVPGTAFPEGLFDRQGRPLLPGSTPTMGYEDAVPREARALLLVNPTAGQLAAVAAGAPAGVRVLVLVDVA 80 
41057155  81 RQDMPFSVV 89 
41057528  81 YCAPPFSIV 89 
289183857 81 RRDMPFSVV 89 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap