Conserved Protein Domain Family
PHA02676

?
PHA02676: PHA02676 
A-type inclusion protein; Provisional
Statistics
?
PSSM-Id: 177458
View PSSM: PHA02676
Aligned: 4 rows
Threshold Bit Score: 786.418
Threshold Setting Gi: 289183868
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057538    1 MESEDSLVARFKSLVQRHWHHPLKSVSCIPREDRKLIRDILRKYIQLAPPIEGK-NVANRPLNLYFRKYIEQNPMYRKIF 79 
41057165    1 MESDNALVARFKSLVERHWHQSLSSVSCIPREDRKLIRDIIRRYIQLAPAIDGA-NVAGRPVNLYFRRYVERNPMYRKIF 79 
289183867   1 MENHSSLVSEFKDIVQRQWHHPLGTVICIPRTHRKIIRDVLREYIRSAPKVDGT-KVSRRPVNLYFSKYVNQNTMYKNMF 79 
289183868   1 ---MEKLVEEFRKFVSATWKEQLNENTCIPIHIRKLVRDLLREYIRRAPPLKNEhKKIKRPINLFMKEYVEQNPVYIELF 77 
41057538   80 VDDDWLSKHATTLGAHSKINIVNVSTLGKLYLIVVKKLMTGHIS-HDELIMEFPGVGENSSRDVIDRQTTFFCLDFLNNM 158
41057165   80 VDDEWLSKNAITLGEHVKINVIHISTLGKLYLMIVKKIMTGHVTvTNEPIMDMYDVHERSPSQVIDRKTAFFCQDFLNAM 159
289183867  80 VDDEWMKFHVTMLCEHAKINIINVDTLGKFYLMVVYSIMTGHLTlHNERIMDILGVTEDSTRKIIDSKTGFFCVAFFRDI 159
289183868  78 KNNVWMHDSAVAIKDFP-----DMYTLGRLLLMAVYRIMTGAT--DTGTIMDSRDPNDETD---VDRQMDYFCYLFLWYM 147
41057538  159 GALASYYTNSAIYFGVPMFWWYGVD-AKSIYKKLETNWK-NPATMEYTRHSLAFIQFMSEVN---GTRVSDKDHVKIVFE 233
41057165  160 GTLAHWYSNPAIYFGVPMYWWYGVD-AKSIYRILETGWTyNGKIHEETRNSLAFIQFMSEVN---GNDVRDKDHVKVVFE 235
289183867 160 STLASHFRNTAIYIGLPIYWWYGVD-VNDVYIKIEKLVS-DIRTIEYARGVLAIIQFMKEVN---GTDVKDKDHVKISFD 234
289183868 148 GSIALQYKNKSLIIGIPMYWWRGEElVKLVHLKLDQHFN-EYDPDKFSNGAVSFARYMSNTYdkvGDDSSSIPHINISFS 226
41057538  234 KlHIFQFVMSVPEFVMDGLCFTAWDTFSKTGTSFTMDIFIHPSEHDGAVYKSVDHDVQGVLEQLSRPETIDCSAVRVSYY 313
41057165  236 KlHKFQFVMSVPEFIMDGLCFTAWDTFSKVGTSFTMDIFIRPSEHDGAVYKSVDHDEQGDLEQLTRPNTIDCSAVRISYY 315
289183867 235 D-HKCRFVMSVPEFMMDGLCFTAWDEFSKRGTSFTMDIFITPSEHDGAVYKSVDHDQQGVLERLPKPSTVDCSAVRISYY 313
289183868 227 G-FSTNFISSVPEIILDGLCYTVYDKITKYGTTFYLDVFMNPTRYNGFTYKTLDHSKQGVVDGITKDDVGNRGAIRFKFH 305
41057538  314 PS--------------------------VHTSKDENDITPP--------GSYDLYYYEYGDPNNISRNYYERRDRLTYDG 359
41057165  316 PDv-------------------------IHVSNDENDLKKP--------GAYDLYYYEHGDPNNISRNYYERRDRLTYDG 362
289183867 314 PDg-------------------------IHRRNDENDIASP--------GPGDIYYFEYGDAYNISRNYYERRDRLTYDG 360
289183868 306 PSfsrrvsyrptggvtairhpnykedtyVKQHNVDNNQTPTiftrnydnNGYYLDYHHYSHTEDSINNEFERRDKLTYDN 385
41057538  360 RCDQRHRVWTHEDSDGTTYLRMLWDRYDGNIPVSP-------FpqkPVGSSGSVCVLPQRVDALLKPLEETIATAKTCCE 432
41057165  363 RCGEHRRVWTHPDLDGTTYLRMLWDRYDGNIKVTP-------F---RVGFDGSACVLPERVDKLLAPLEKTLAEAKTCCE 432
289183867 361 RCHEHRRVWTHSDPDGTTYLRMLWDRYDGNIKVTP-------F---KVGFDGSACVLPERVDKLLSPLEKTLAEAKTCCE 430
289183868 386 VVCLKHRFDGDIDNDKTSYHRILRDRFVGLLSTKPplsevevIgddEDNNDNPLCMDIDKLDKLISPLENYVKDKPCCSK 465
41057538  433 ENREAGKHLEHHIETMRQYAVLVSNKTDVQTCNRPGAEVTKHAIDGSLPPPHVLGNWGVRSDCGQRRPPRVSHGGPKPWW 512
41057165  433 SNRKAGKHLEHHIETMRQYAVLVSNKTDVHTCRRPGAEVTRHALDGSLPPAHARGDWGARSYCGARRSQPRVSHGEKPWW 512
289183867 431 SNRAAGRHLEKHIETMRQYAVLVANKTDVHTCHRPGAELTRHAIDGSLPPPHVLGNWGARSYCERQRNSPRVSHGEKPWW 510
289183868 466 ITVGLG------------------SSTNTTSSNYPIVRETYRPTWTRTPHTSIF-----------NRHYPYNTYNLDAWW 516
41057538  513 -WGRHAAIW 520
41057165  513 -WGQHAAIW 520
289183867 511 -WGRHAAIW 518
289183868 517 rRQRHGAIW 525
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap