Conserved Protein Domain Family
PHA02675

?
PHA02675: PHA02675 
ORF104 fusion protein; Provisional
Statistics
?
PSSM-Id: 177457
View PSSM: PHA02675
Aligned: 3 rows
Threshold Bit Score: 165.962
Threshold Setting Gi: 41057540
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289183869  1 MEEGDGENLLGPTTDEPNNDDNGVYAAGApPSKESIEGRLVDLLESYRTITECCRETGARLDRLERHLETLREALLKLNT 80 
41057167   1 MEENDGENLLAQPDDDTGNSTNGVYAAGA-PTKESVEERLVSLLDSYKTITDCCRETGNRLDRLEKHLETLRRALLDLNR 79 
41057540   1 MDENDGENLLGTGVNE--NDGSAVYTAGA-PSSESVEERLVSLLDNYKTITDCCRETGARLDRLERHLESLRTALLNLNT 77 
289183869 81 KIDVQTRYGRY 91 
41057167  80 KIDVQTGYSRY 90 
41057540  78 KIDVQTGYSRY 88 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap