Conserved Protein Domain Family
PHA02674

?
PHA02674: PHA02674 
ORF107 virion morphogenesis; Provisional
Statistics
?
PSSM-Id: 177456
View PSSM: PHA02674
Aligned: 3 rows
Threshold Bit Score: 89.4009
Threshold Setting Gi: 289183872
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057543   1 MDEDINETALIHMLTRLTQLCSGDAAAAAAAIKMLMDLVNERIMALNKKAKKEVRNASPS 60 
41057170   1 MEEDLNEAGLLHMLTRIAQICGGDAAAAAATIKMLMDLVNERIMILNKKAKKEMGQASSA 60 
289183872  1 MEEDLNEAALLHMLTRIAQICGGDAAAAAAAIKMLMDLVNERIMILNKKAKKEMTQLSP- 59 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap