Conserved Protein Domain Family
PHA02673

?
PHA02673: PHA02673 
ORF109 EEV glycoprotein; Provisional
Statistics
?
PSSM-Id: 177455
View PSSM: PHA02673
Aligned: 3 rows
Threshold Bit Score: 240.966
Threshold Setting Gi: 41057172
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057545    1 MAHGTFgDNDSEAAANATYVASVKRQKAIRRCIKLFFRLMAALAIIILAALVIILALALSDCRNTTCVID-TNSYNRTCD 79 
41057172    1 MAHNTF-ETDSESANNANYVASVKRQKAIRRYIKLFFRIVAAIAIIVLAILVVLLALELDKCKEQSTHQDyHHTTNKTCD 79 
289183875   1 MAHNTF-DNDSEANNNANYIASVKRQKAIRRYVKLFFRFTAAIAIIVLAILVVVLALSLDQCLHNEHPHD--DVYNSTCD 77 
41057545   80 GINAGNR-CLTLKYPDTWTNANERCKELGQRLPKPSDNEKYPWLTDYLVNTWGNiNERVFGTSGGLESV--TMDGSTNKY 156
41057172   80 GLFPENKwCLTKFDPFTLRQAKSMCTGIGQTLPSEDIVKLYPWLGKYLTGTWSD-KGGVFGSSGSTSEVwsGASEQEKAF 158
289183875  78 GIPLGNK-CLTLHTSSTWEEANLSCGRLGFHLPSTGIHKKFPWLVTHLDGTWGStKNSIFNPTGETQQV--MGPQEVHKY 154
41057545  157 FCVDDN 162
41057172  159 FCVAKL 164
289183875 155 FCVSD- 159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap