Conserved Protein Domain Family
PHA02672

?
PHA02672: PHA02672 
ORF110 EEV glycoprotein; Provisional
Statistics
?
PSSM-Id: 177454
View PSSM: PHA02672
Aligned: 3 rows
Threshold Bit Score: 304.12
Threshold Setting Gi: 41057173
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057546    1 MGCCKVPNRQSLRSLKKASCPVATLVTMLSLVTSLGAIIKYTGFFLREACEDGWIPIKDICVLNTHHQSDTTRAHEICRY 80 
41057173    1 MGCCRTPNRQCLLTLKRASCPVASLVSVLSVFTSICAIIKYTDLFLKEACENDWVPIKDLCVYNTQVITNVTLARDICAS 80 
289183876   1 MGCCRIPNRQSVRTLKKASCPVATIVTILSLITSLGAIARYTKFFLKEACDEGWMPIKDVCILNTHFETTHYDAHRICKN 80 
41057546   81 FKGTPPAIPNTSLLRGVMAVTGERHFWLGHHDKYTSVYEDAPfGRRVPYQNVEYDKAKHFCLLSADGYIHHNCALNATVI 160
41057173   81 MDSDLPATPDTMFLKGIMFLVEATSFWMTHHDAYKNVYLPKR-GSYLRSYVEEYNKDTHVCLINLQGLMHHDCNQNTTVV 159
289183876  81 LDGKPPAVPNPTLLKGIMVMTGERQFWMTHHEDYTSVYEHTG-GGTIP-KNTKYDKDKHTCLLSEDGILHHNCMMNVTVV 158
41057546  161 CVKKMYG 167
41057173  160 CVKKMYN 166
289183876 159 CMKEMHG 165
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap