Conserved Protein Domain Family
PHA02671

?
PHA02671: PHA02671 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177453
View PSSM: PHA02671
Aligned: 3 rows
Threshold Bit Score: 351.892
Threshold Setting Gi: 41057547
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057174    1 MSRLQILTSFGQIYAPDEARLREIARDLGICTIKRAFGDMLYGFIDFNPVPLTQVNMLMSNCYFAVNGNLLPCTEDFRLR 80 
41057547    6 MSCLQILTPFGLIFAPDDVRLREIALELGITYVSRAFGDMLYGEMSFTSLPMNEVPACVSDCYLAVNGNLIPCTESFRLR 85 
289183877   1 MSHLQILTSFGQIYAPDEARLREIARDLGICTIQRAFGDMLYGYISFSQIPLTQVNMLMPDCYFAVNGNLLPCTEDFRLR 80 
41057174   81 LPATEISAAYLTKTGRTILCGKDFNIIAPLGFKPSMRLRNLSHVSALVEILEFYSESGEYQFVLGPSAQFMLRLMEKENV 160
41057547   86 IPMDGVKAAYRTGTGKTILCGPEFNVVNPSGFRPALRLRELSHVAAHTEILELYSESGNYEFIMGPSARFMTSLMAKESV 165
289183877  81 LPATEISAAYLTSTGKTILCGKDFNIVTPSGFKPSMRLRDLSHVSALVEILEFYSETGEYNFILNPSAPFMLRLMEKENV 160
41057174  161 CLFGSGWCIVDLRKLDVTI 179
41057547  166 CLFGSGWCVVDLRRISFTP 184
289183877 161 CLFGSGWCIVDLRRLNVTI 179
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap