Conserved Protein Domain Family
PHA02669

?
PHA02669: PHA02669 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177451
View PSSM: PHA02669
Aligned: 3 rows
Threshold Bit Score: 281.143
Threshold Setting Gi: 41057176
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289183879   1 MYPLVVIAIILAVICLTGAAIYLLVEIGLAAERANKRVRVKRNMRKLASQLGNGTLDSSIG-PCTISRNMEsaLGASRWD 79 
41057176    1 MEVLVIISIIVAVIFLTGAAIYLLIELGLAAERANKRARVKKNMRKLATQLGNGSVDSGIG-PCTISRTMD--FGPSRWD 77 
41057549    1 -MALVLIGLIVGAFYLTAAIIYLLIEIGLAVERLSKKSRAKAHMRQLSTQLGSGTLASTMGtPIPVMGDIG---TCSRWD 76 
289183879  80 SDTE-DGDTVSTTSTSGGggeGTLTRVCVRGGPhvtAPMYENFCGSGNRHFPPVNDPGYHSRETL-----CSGPPRQAQV 153
41057176   78 SDSEgDGDSLSTTSTSGG---GTLPRVWVGGGP---GPMYENFCGNGTHRHSPTNDPGYHSRETL-----CSGPPRQAPE 146
41057549   77 SDTE--GETVSTTSTSDG---GTLSR----QQSrfqHRLYENF---------QSGDPGYHHRDTFqvqvrNSGTPPVDNI 138
289183879 154 PPA-----TPTPDEVTVDVGSGPG-EPGAYEdpipmqgpEPEQVQIEVTVTGAGGEGEVEGEFFYDE 214
41057176  147 PLT-----TPKPDEVKVEVGPGPDdRQGLYE--------EPEPVQIEVTVNGPGGEGEEEGEFFYDE 200
41057549  139 PPVpkvdePPYDDAESSGVGSMGStEHIHSDgdgpeqdlPPPPAHDEVSLQ------DECDDFYFEE 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap