Conserved Protein Domain Family
PHA02668

?
PHA02668: PHA02668 
GM-CSF/IL-2 inhibition factor; Provisional
Statistics
?
PSSM-Id: 177450
View PSSM: PHA02668
Aligned: 3 rows
Threshold Bit Score: 461.729
Threshold Setting Gi: 41057553
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057180    1 MACLRVFLAVFALCGSVHSAQWIGE-RDFCMAHAQDVFARLQVWMRIDRNVTAADNNSACALAIETPPSNFDADVYVAAA 79 
41057553    1 MWLPRALLALSVICGTASSYRGMHDgGEFCRAHSREIFTSFQMWMRIQRNVQTARNATQCALDVEAPPDMFDVVAYANTA 80 
289183883   1 MACLRVFLAVLALCGSVHSTPWIGE-RDFCAAHAQDVFSRLQVWIRIDRNVTTADNSSACALAIETPPSNFDADVYVAAA 79 
41057180   80 GINVSVSAINCGFFSMRQVETTYDTARRQMYVYMDTWDPWVlDDPQPLFSQ---EYENETLPYLLEVLELARLYIRVGCT 156
41057553   81 GIAVTVATANVGRVDVRTLQVLYSTNKSSMFVYLDTWSPWT-KYTRPLYSNasaDAHNETIDCLLEVLDLNKVHVDVGCA 159
289183883  80 GINVSVSAINCGFFNMRQVEATYDTARRQMYVYTDTWDPWVlDNPQPIFSQ---EYENDTLPYLLEVLEFSRMYIRVGCT 156
41057180  157 VPgEQPFEVITGIDYPH-TSMEFLQHVLRPNRRFAPAKLHMDLEVDYRCVSAVYVKAFLQDACSARKARTPLYFAGHGSN 235
41057553  160 VE-DIPVDVVDPIDYPRvYDPDLLRYVIPKNRKQNPGYVFVDLSVDSYCVHSVNVKTVLRDACIHHKNETPLNFYGRENF 238
289183883 157 VPgEQPFEVIPGIDYPH-HSMEFLQHVQRPNRRFSPAKLHIDLEVDYRCVSAVHVKAFLQDACSARKARTPLYFAGHGSN 235
41057180  236 HPDRRPKNPVPRPQHVSSPmsrkCLMQTAR 265
41057553  239 PLHKSPNSVIPTHKRGFST----CEMITGQ 264
289183883 236 HPDNRPKNPVPRPQQVWSSssrkCRMQTVR 265
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap