Conserved Protein Domain Family
PHA02665

?
PHA02665: PHA02665 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177448
View PSSM: PHA02665
Aligned: 3 rows
Threshold Bit Score: 608.056
Threshold Setting Gi: 41057557
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057185    1 MANRLVFLDPETLAEADGIPSQGVFEPGKKKCVFTKIRTSVALACRYAVSDGGLIDELVMATYGARRACRLVRHLTISAE 80 
41057557    1 MDNKLVLLDFEHLAEADSIAEQCVYEPAQKKCAFTKIRTNSSTAARYTVADGCMLDDLMNASFGTRRACRLVRHVVVGSD 80 
289183885   1 MANRLVFLDPETLAEADGIPGQGVFEPGKKRCVFTKIRTSSTLACRYAVSDGGLIDEFVMATYGTRRACRLVRHLTISSE 80 
41057185   81 GVMTRPASNCAPHMVLICLRGVAAVSSEDMVFGRCIMERGTMFMVKSAHSAVVCGNPACELLVLFYDHFTPIPRSLSGDE 160
41057557   81 TVLSRQAADCAPHMVLICVRGIAHVSGDALKFGRCTMDRGTMFMVKSSRSSVVCGNPACELLVFFVDFFMPIPRVLLPDE 160
289183885  81 GVMTRPASNCAPHMVLICLRGVAAVASESMGFGRCIMERGTMFMVKSSHSAVICGNPACELLALFYDYFTPIPRPLSGEE 160
41057185  161 VLFTRDLAHVDYPPESAVVFKMDYDLATDVATLFVGGYIFRVRGLEMETREQVGDECDCCRHSSPVLVMDREKMMSSLRM 240
41057557  161 VLFTRDLTHVESDANSSVIFKVEFDLSENVCKLFIKGYIIRVTGMQLERRETVCDDCDCCYPEAPVLALDRKKLHRSART 240
289183885 161 VLFTRDLAHVDYCPQSAVVFKMEYDLATDVATIFVGGYIFRVTGLEMETREQVGDECDCCRHSSPVLVMDREKLMSSVRM 240
41057185  241 IPSTVPGQRSICLRERGWAVLETDARGHCEPGVLRLALAGLRLFAGCLRSVVGRRELSLFCYGIVPkFGGEFDDAPRP-M 319
41057557  241 VPTLIPGVLDLHLKERGWLMASIDAKGHCEPALLRIALGSLRLVCGILRSAVGRYHNMLFFYGIIP-VNREADAAPAEmM 319
289183885 241 IPSLVPGQRELCLRERGWCVMRTDARGHCEPGILRLALAGLRLFAGCLRSAVGRQELLLFCYGIAPrFGGEFEDAPSP-M 319
41057185  320 EID 322
41057557  320 EIE 322
289183885 320 EID 322
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap