Conserved Protein Domain Family
PHA02664

?
PHA02664: PHA02664 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177447
View PSSM: PHA02664
Aligned: 3 rows
Threshold Bit Score: 827.717
Threshold Setting Gi: 289183887
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289183887   1 MDPAG----QRLRGPGPWRLNPPTAAALEGAVLRPAAAAGAHRCVNATVDSRHMGVGEGREVPADIEGLMTEIHLRFGMT 76 
41057187    1 MDPAG----QRLRAPGPWRLNPPTAAALESAVLRPAASAGADRCANAHVDSRNMGVGEGREVPADVEGLMTEIHLRYGMT 76 
41057559    1 MERFGagepARLRNPGPWRISPPMASALEGAMLNPVVAHGTDLCANARVETRNMGVGEGRHIPADVEGLRTEVHLRYGMS 80 
289183887  77 RVLRNVHFVQFWHGEHVRRRPARHVFTVWVCLSGEVRIYAECCQAGHGFVLCRQMAAGYMFVTEPTDSVTISVPHRMRNS 156
41057187   77 RVHRNVHFVQFWHGEHVRRRPARHVFTVWVCLSGEVRIYAECCQAGHGFVLCRQMAAGYMFVTEPTDSVTVSVPHRYRNS 156
41057559   81 RVHRTMYFAQFWHGEHVVRRPSRCVFTVWVCLYGEVRVYAESCQAGQGFVLCRQLPAGHMFITEPSDMVTVSVPHALRGS 160
289183887 157 RSPVWLAAVFATRHFEPLPPPMYAVPGHVVLARSASMLCDCWPSDPQRRNVVFYLRLSGSMVRVTVPGAELEIECTSGFA 236
41057187  157 RSPVWLAAVFATRHLEPLPPPMYAVPGHVVLARSASMLCDCRPSDPRRRNVIFYMRLSGAMVRVIVPGAELEIECTSGFR 236
41057559  161 RRPVWLVCVFATRHFEDLPPPLYPVPAHVVLARSASELCNVSPSAPQRQHGIFFMRLSGTVVRLTMAGAELEVECTS-HR 239
289183887 237 PDHFSIDDECVCCQaRPHVARTAVWPLAEICRGATVVLAPPLARDRAAGLLAEIRLASQRWVRVRAIRSGRGDMGPLPSV 316
41057187  237 PDHFSIDDECVCCE-RPHVARTAVWTLAEICRGATVVLAPPLPRDRAAGLLAEIRLASLRWVRVRAVRSGRESVGPFPSV 315
41057559  240 PDHMAVDAECRCCElRPHVPRSRVLTLVELCSGATVVLAPPLPRG-GTGLVAEIRLHSGHHIRVRVLRSATGNVAAFPSV 318
289183887 317 VWAATFSAIRLFMEGTVPAFAACVENGRAAYGMVYVPPEEPRM-DGLCVFPTPAEPAALFVRGEEVIAAGAAAAMIAAAE 395
41057187  316 VWAAVFSAVRLFLDGTVLAFPACVENGRAAYGMVYVPPEEPRM-DGLCVFPTPAEPAALFVSGDQVLEAGAAAAMIAAAE 394
41057559  319 VWTGVFCAAHVFLGGSVPAFAACMDGGRGAYGLVFIPEGEERMsDGVTTFPTPREPVALHIDAN----GADARAMLNAP- 393
289183887 396 RAANgeaaggaGARGSPAAAGEAASEAMETAGGGAAADDDMEAEAHDfeiEFDQDPGAPAGAARADSDSDEDDESsgpES 475
41057187  395 KSVQ-------AANGSPVAAEEEMNAAADAAAESVEQDQHVEFDPGP---DPDPSQEAPADAPRADSDDDTGSET---ET 461
41057559  394 ---------------PPMEAPREGRAPAAAGAANAPADQDVD--------------GAPDHRDAGDAEEDDMDAQ----- 439
289183887 476 GDERARSEDDSDSSdSYSAFSSSDEDDSddADDSWGD---SDSGIEEDDDGVGQAIEEEEEEERQVLGAVAEMLGD 548
41057187  462 GDESVGGEDDSDSS-SYSVMSSDDENDS--GDEGWGDs--SDSGIEDDDGGVGQAAEEEEEEERDVLGAAAQMLGD 532
41057559  440 -----DGESDAESEySYATTSSEEDSDS---DDSWDDessSDSGIEHDDGGAGQVIEEELAEEAAVLNAVAEMLD- 506
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap