Conserved Protein Domain Family
PHA02663

?
PHA02663: PHA02663 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177446
View PSSM: PHA02663
Aligned: 4 rows
Threshold Bit Score: 291.081
Threshold Setting Gi: 41057188
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057560    6 HRDDTDIDASAVVTAYLASEYANAVIDNLSDAERVALEALRASGDEVRHPMLQELTNAGGNHANPETSHIPATLISALLE 85 
41057188    1 MANRDDIDASAVMAAYLAREYAEAVEEQLTLRERDALEALRVSGEEVRSPLLQELSNAGEHRTNPENSHIPAALVSALLE 80 
289183888   1 MANRNDIDSSAVVAAYLAGQYAAAVEEQLTPREREALAALRISGDEVRSPLLRELSNAGDYRANPENSHIPAALVSALLE 80 
289183771   1 MANRNDIDSSAVVAAYLAGQYAAAVEEQLTPREREALAALRISGDEVRSPLLRELSNAGDYRANPENSHIPAALVSALLE 80 
41057560   86 APASPGRMVTAIELCAQMGRRWTRRFQFLNFMRLVHVLVDRMPPTASEDLAVWLERAARVQATRHRMSRVAGLGMFLAGC 165
41057188   81 TPTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV 160
289183888  81 APTSPGRMVTAVELCAQMGRLWTRGRRLIDFMRLVHVLFDRMPSTANDDLAAWLQTVARVHRSRRWLHRSIGVGTVMAGV 160
289183771  81 APTSPGRMVTAVELCAQMGRLWTRGRRLIDFMRLVHVLFDRMPSTANDDLAAWLQTVARVHRSRRWLHRSIGVGTVMAGV 160
41057560  166 GILFVGARFLRR 177
41057188  161 GMLLLGVRVLRR 172
289183888 161 GLLFLGVRVLRR 172
289183771 161 GLLFLGVRVLRR 172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap