Conserved Protein Domain Family
PHA02662

?
PHA02662: PHA02662 
ORF131 putative membrane protein; Provisional
Statistics
?
PSSM-Id: 177445
View PSSM: PHA02662
Aligned: 4 rows
Threshold Bit Score: 249.202
Threshold Setting Gi: 41057566
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289183766   1 MPprtPRTPPTPPRPPEPTPAAPGSLYDVFLARFLRRLAARAAPASAACAVRVGAVRGRLRNCELVVLNRCHTDAADSLA 80 
41057194    1 MP---PRTPPTPPHYPEPTPAAPGSLYDVFLARFLRRLAARAAPASAACAVRVGAVRGRLRNCELVVLNRCHADAADALA 77 
41057566    1 MP---PPTLPTPPQ-PDPVRADTGSLYDAFLARFLRALAARAAPASAACAVRVGAVRGRLRNCELVVLNRCHTDATEALA 76 
289183893   1 MPprtPRTPPTPPRPPEPTPAAPGSLYDVFLARFLRRLAARAAPASAACAVRVGAVRGRLRNCELVVLNRCHTDAADSLA 80 
289183766  81 LASAALAETLAELPRADKLAVAKELGVDPEHPQLTPDPAC-AGESALAQNIDVQTLDLGDCGDPRGRRLRVALVNSGHAA 159
41057194   78 LASAALAETLAALPAADRLAVARELGVDPEHPELTPDPAC-AGESALAQNIDVQTLDLGDCGDPRGRRLRVALVNSGHAA 156
41057566   77 LASSALADTLASIPREDRIAVAKELGIDPDKPQLTPDPACtAAEGALAQSIDLQTLDIGDCGVPGGRRVRIALVNSGHAA 156
289183893  81 LASAALAETLAELPRADKLAVAKELGVDPEHPQLTPDPAC-AGESALAQNIDVQTLDLGDCGDPRGRRLRVALVNSGHAA 159
289183766 160 ANCALARVATALTRRVPASRH-GLAEGGTPPWTLLLAVAAVTVLGVVAVSLLRRALRIRFQYSKPLNTLRV 229
41057194  157 ANCALARVATALTRHVPASRH-GIAEGGTPPWTLLLAVAAVTVLGVVAISLLRRALQIRFRYSKPIQTLRV 226
41057566  157 TNCALAKVASALTKRVPVRRQeGLAAGGMPPWSVLLSVAAVVVVGTVAVSLLRRALRLRFRFA---TRLRV 224
289183893 160 ANCALARVATALTRRVPASRH-GLAEGGTPPWTLLLAVAAVTVLGVVAVSLLRRALRIRFQYSKPLNTLRV 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap