Conserved Protein Domain Family
PHA02660

?
PHA02660: PHA02660 
serpin-like protein; Provisional
Statistics
?
PSSM-Id: 165039
View PSSM: PHA02660
Aligned: 4 rows
Threshold Bit Score: 674.049
Threshold Setting Gi: 62637383
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956278   1 MKKYCILNNNIIkmsLDLGFCILKSLHRFNVVFSPESLKAFLHVLYLGSERETKNELSKYIGHSYSPIRKNHIHNITKVY 80 
62637383    1 MKKYYILNNNIM---LDLGFCILKSLHRFNIVFSPESLKAFLHVLYLGSERETKNELSKYIGSAYSPIRKNHIHNITKVY 77 
62637547    1 MKKYYILNNNIM---LDLGFCILKSLHRFNIVFSPESLKAFLHVLYLGSERETKNELSKYIGSAYSPIRKNHIHNITKVY 77 
211956440   1 MKKYCILNNNIIkmsLDLGFCILKSLHRFNVVFSPESLKAFLHVLYLGSERETKNELSKYIGHSYSPIRKNHIHNITKVY 80 
211956278  81 VDSRLPIHSAFVASMNNMGIEVILEDLTNHAEPIRRSINEWVYEKTNIINFLHYMPDTSILIINAVQFNGLWKYPFLRKK 160
62637383   78 VDSHLPIHSAFVTSMNDMGIDVILADLASHAEPIRRSINEWVYKKTNIVNFLHYMPDTSILIINTVQFNGLWKYPFLRKK 157
62637547   78 VDSHLPIHSAFVTSMNDMGIDVILADLASHAEPIRRSINEWVYKKTNIVNFLHYMPDTSILIINTVQFNGLWKYPFLRKK 157
211956440  81 VDSRLPIHSAFVASMNNMGIEVILEDLTNHAEPIRRSINEWVYEKTNIINFLHYMPDTSILIINAVQFNGLWKYPFLRKK 160
211956278 161 TTMDIFNMDKVSFKYVQMMTTKGIFNAGRYHQSSIVEIPYDNCSRSRMWIVFPDATSNDQLNQLENTMHGDTLKAFKHAS 240
62637383  158 TTMDIFNIDKVSFKYVNMMTTKGIFNVGRYHQSNIIEIPYGNCSRSHMWIVFPDAISNDQLNQLENMMHGDTLKAFKYAS 237
62637547  158 TTMDIFNIDKVSFKYVNMMTTKGIFNVGRYHQSNIIEIPYGNCSRSHMWIVFPDAISNDQLNQLENMMHGDTLKAFKYAS 237
211956440 161 TTMDIFNMDKVSFKYVQMMTTKGIFNAGRYHQSSIVEIPYDNCSRSRMWIVFPDATSNDQLNQLENTMHGDTLKAFKHAS 240
211956278 241 RKKYLEISIPKFRIEHSFNAEHLLPSAGIKTLFTNPNLSRMITQGDKEDDLYSLPPSLYQRVILEIDEEGTNTKQTAKKM 320
62637383  238 RKKYLELSIPKFRIEHSFNAEHLLPSAGIKTLFTNPNLSRMITQGDKEDDLYPLPPSVYQKIILEIDEEGTNTKNITKKM 317
62637547  238 RKKYLELSIPKFRIEHSFNAEHLLPSAGIKTLFTNPNLSRMITQGDKEDDLYPLPPSVYQKIILEIDEEGTNTKNITKKM 317
211956440 241 RKKYLEISIPKFRIEHSFNAEHLLPSAGIKTLFTNPNLSRMITQGDKEDDLYSLPPSLYQRVILEIDEEGTNTKQTAKKM 320
211956278 321 RRSPQdEETQQHLLRVESLYVNRPFIFIIEYENEILFIGRISIP 364
62637383  318 RYNTQ-EDTYQHLFRIESIYVNRPFIFIIEYENEILFIGRISIP 360
62637547  318 RYNTQ-EDTYQHLFRIESIYVNRPFIFIIEYENEILFIGRISIP 360
211956440 321 RRSPQdEETQQHLLRVESLYVNRPFIFIIEYENEILFIGRISIP 364
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap