Conserved Protein Domain Family
PHA02658

?
PHA02658: PHA02658 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165037
View PSSM: PHA02658
Aligned: 2 rows
Threshold Bit Score: 134.039
Threshold Setting Gi: 211956302
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62637407   1 MNKLIMTIKNKLNTLTDKEIIQGNKFKYGELKPSEMYKKHHKYVYKNGTTGGESRPLISAVVKKVTNKKKKKPYRVTYYI 80 
211956302  1 MNKLIMTIKNKLNTLSDKEVIRSNKFKYGELRPSEMYKKHHKYVCKNDTTGGESRPLISAVVKKVTNKKRKKPYRVTYYI 80 
62637407  81 NEDMDDNDDVFI 92 
211956302 81 NEDMDDNDDVFI 92 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap