Conserved Protein Domain Family
PHA02657

?
PHA02657: PHA02657 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165036
View PSSM: PHA02657
Aligned: 2 rows
Threshold Bit Score: 147.865
Threshold Setting Gi: 62637406
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956301  1 MANTTEAPTTTLPADNYYYMKINFESMLVFTIFVFVVCILIYLLIYLVDWSLVKDACNRFKTQVLKILSLSKTHFTRLDG 80 
62637406   1 MVNATMTPLTTLSVDNYYYMQINFGTILVFTIFIFVVCILVYLLIYLVDWSLVKDACNRFKTQVLKILSLSKTHFTRLDG 80 
211956301 81 VYYTDEREVLGIDVE 95 
62637406  81 VYYTDEREVLGIDVE 95 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap