Conserved Protein Domain Family
PHA02656

?
PHA02656: PHA02656 
viral TNFR II-like protein; Provisional
Statistics
?
PSSM-Id: 165035
View PSSM: PHA02656
Aligned: 2 rows
Threshold Bit Score: 362.768
Threshold Setting Gi: 62637395
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956290   1 MINYKLLTSFIFFITCYHVSKGSNyEEITNTFTMFVDLTVYDKNLTTrDVSCIRYSYDDFYSMYIVNKFNVSITLSGCDD 80 
62637395    1 MIKYTLLTSFIFFITCYHVSKVSN-EEIQNKFTMFVDLTVYDKNLIN-DVSCKRYDHDNFYSMYIIDNFNVSITLSDCGD 78 
211956290  81 AGFTEAYYTNVRDYTMELGYFTPADKKYKGLSENKKCVVKVVITCDGEENNLVQTPKNFKYSHPKHKDHKEKLMLYGTCI 160
62637395   79 AGFTEGYYTNVRNNTMELGYFTPIIMKYKGLNFDSRCIVRIIITCDGDDNNLVMTPQRFKPKKQKHADHIEKLILYGKCI 158
211956290 161 SGVLVDIVYDYGFTRDVSSIQYGTVHRVSGLFPRSCvPR 199
62637395  159 DGIKADVTYDYGSVRDTSSIIYGTISDISGLLPNTC-PK 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap