Conserved Protein Domain Family
PHA02655

?
PHA02655: PHA02655 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165034
View PSSM: PHA02655
Aligned: 2 rows
Threshold Bit Score: 96.19
Threshold Setting Gi: 62637391
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956286   1 MVKTTKKTAVYYIYNDTIEKRINDWSHYFIITFLVSLFISICFIIKLDIKEIIKNQYTMLKFVVFTIYLIPFVIVMISCI 80 
62637391    9 MVRTTKKTAVYYIYNDTIEKRISDWSHYFVITFLVSLFISICFIIKLDIKEIIKNQYTMLKFVVFTIYLIPFVIVMISCI 88 
211956286  81 FLVIIYIKYHKQNY 94 
62637391   89 FLVIIYIKYHKQNI 102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap