Conserved Protein Domain Family
PHA02653

?
PHA02653: PHA02653 
RNA helicase NPH-II; Provisional
Statistics
?
PSSM-Id: 177443
View PSSM: PHA02653
Aligned: 27 rows
Threshold Bit Score: 744.491
Threshold Setting Gi: 9964395
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964395     1 MQEIKNIYdfktynlfpelhnkynyishlLFPNNTNIFQSYIDFDYVKKY--------KYNFLILLYPVYKLYWKNMYIC 72 
40556047    3 TNELFSIY---------------------AFPNMYDIFPHSYTYKELEEYhn----kdTLFFSHSVFPIIKHRWNKVFIC 57 
41057472    2 ENPLPEML---------------------LFPNCVTVFPFEYALEDVLRLpd----etRRAFALAAFPLVKHRWRGARVE 56 
41057099    2 ENHLPDML---------------------MFPNCVSVFPFEYSLEDVFRLpe----erRRAFAMAVFPLSKHRWRGARLQ 56 
9628982     1 MKNLPGVF---------------------AFPDNETIFAHAYSQRELEAMlparagaqPHAFAYAAWPLSKHRWRGAFVC 59 
9634752     3 TNDLFSIY---------------------AFSNMYDIFPRKYSQKELEEYhr----knPLFFSYTIFPVIKHRWSKAYIC 57 
9633680     2 ENHLPNIF---------------------YFPNCVTAFPYRYTQKELDDMkp----vdRERFKYAVFPLIKHRWCRAYVV 56 
9633853     2 ENHLPNIF---------------------YFPNCVTTFPYRYTQKELDDMkp----deRERFKYATFPIIKHRWSHAYVV 56 
115531735   1 ---MLDLF---------------------AFPNNVDVFPHEYSQERLEELna----adPSAFSLAVFPVHKHRWADAYVV 52 
157939672   2 DNHLPEIF---------------------YFPNCVDIFSHQYSQIEFNKMek----ttKKNFSLAVFPIIKHRWKKSFIV 56 
9964395    73 YNQNSNKIYLDNKEIYNtsieLINDFLID------GIDINNNIITIRSNG-STITYSAYAYATILYDLPYRLGNldINQI 145
40556047   58 LKDDTYMLNIETTNS------ISAKIPVSklidviPVSINYSKQVYYIGNdRFITFECYSYVKCIGYNHVSDIT--LDDK 129
41057472   57 RNDRRVWLDVEREARAAavaaSTSALLDD------------AMDRLVDDQgRVITPEAYAFMRCAPGARVAELAddVAAI 124
41057099   57 RDERSVWLSVE-EDRGRalgeRNCSWLSD------------VAARMVDDEgRAVTPEAYAFMRAAPGARVAELAadAGVL 123
9628982    60 RQRGVLKLNLELDAGAFervpRSEAERFE------PEQSDARALMHRGADgTVMSFECYSFLRCRPGLELREAG--LALL 131
9634752    58 FQNNVYMLNIELDTSK-----PYDRVPIQhlidirPISTDIKKEIYKISDkTFITFECYSYLKCKGYNSIYDIT--LDDK 130
9633680    57 RDNHTFKLNVETSKRLRr---VAYPTLVP------LVGVNAALREYVMEDgTKISFECYSYLICKRTTSLHDVD--DSTI 125
9633853    57 KDNHVFKLNVETSKRLRr---ATPPTLSV------PVSMNTMLREYITQDgTKISFECYSYLTCKKATSLHDLD--DNAI 125
115531735  53 RARGVYRLSAEVRTALPeadaAPLEDFVP---------VRTYADHHEAGG-VKVSLECYSMLQCRRGLRLADLG--LAVK 120
157939672  57 IDNGIFKLNLESENNNKikknIKIDTY--------PESIDIQLKIYTVGN-LKITFECYSYLMCKQIKDINLFN--EYIL 125
9964395   146 FGIVESSNILGILSTN-----EEQKKKFPKYINNIEleknilfKFKESNLRSIQIDVQLKIFDLFINRLNCVVSGGTGIG 220
40556047  130 RGLLVAGNHLSIFSSNk----KVPVKNSIGILNNPN-------PFAIISFKSLSLTTQVHIFDMLKKRKQIVVTGSTGIG 198
41057472  125 AGIVHGGNALRIFSSDsvhakEAWRERSVGVLGNPE-------PLEPVPLASLKPDVQQTLFAAWCRRRPVVLTGDTGVG 197
41057099  124 AGLVAGGNALRVFSSEstqarEGWKARSVGVLGNAA-------PLAPVPLASLRPEVQRELFAAWIGRRPVVLTGGTGVG 196
9628982   132 RGLVVGGNRMRIFSGVrr--aGASAATSAGMLGNES-------PFERAPFASLRIDAQAALFRAWAARRPTVVTGGTGVG 202
9634752   131 RGLLSAGNILSIFSSNk----QMPEKSSIGILKNPK-------PFTVIKFKSLSLITQLQIFELLRKRKQIVVTGSTGIG 199
9633680   126 RGLVEGGNQLNIFTNS-----VGSVTNTVGIFGNPN-------PFAKVPLKSLHPSMQCKIFTSWARRVPVVLTGDTGVG 193
9633853   126 RGLVEGGNRLQLFTNS-----VGSVKDTVGIFGNPN-------PFMKVPLKSLHPSMQCKIFESWIHHVPVVLTGDTGVG 193
115531735 121 RGLVAAGNRLGIFSAP-----VRTEATSVGRLGNAR-------DFDRVPFRSLGLETQVRLLRHWLDGDVVVLTGGTGVG 188
157939672 126 RGLIEGGNALKIFSKK-----TGYVNSSIGIFGNES-------SFLKIPLTSLKPLAQQKIFNAWLSNKPVILTGGTGVG 193
9964395   221 KTSIIPKIIWWYNLLFDGYNMFNSrisnvsidnfiFDINIIEKNTLLSLPRKTIINSTAINYIKSLGYSEITETPIIIKY 300
40556047  199 KTSQLPKVIMWYNYLFGGWDDIDK-----------IRLDFIPKPIVLSLPRVTLVKSNGNNFLQSLGFSQFEGSPVELKY 267
41057472  198 KTSQVPKLLLWFNYLFGGFDRLDA-----------IH-EFSERPVVLSLPRVTLVRAHTATYLRSLGFVGIDGSPVSQRH 265
41057099  197 KTSQVPKLLMWFNYLFGGFERLDA-----------VR-EFAERPLVLSLPRVTLVRAHTATYLASLGFGSADGSPVSPRY 264
9628982   203 KTSQVPKLLLWFNYLFGGTEDLDV-----------LA-PARERPVVLSLPRVALVRMNGHALRRALGFDALEGSPVELRY 270
9634752   200 KTSQLPKVIMWYNYLFGGWDNLDR-----------VRFDYISRPIVLSLPRVALVKSNGINFLQSLGFSDFEGSPVELRY 268
9633680   194 KTSQVPKLLLWFNYLFGGFTDLST-----------LTFEVQEKPIVLSLPRVALVKLHSETLLTSLGFEEIHGSPVSLKF 262
9633853   194 KTSQVPKLLLWFNYLFGGFVNLST-----------ITFDVQEKPIVLSLPRVALVKLHSETLLTSLGFNEIHKSPVSLKF 262
115531735 189 KTSQVPKLLLWFNYLFGGFDGYDA-----------FRPEFRERKVALSLPRVELVRMNAGVLLRSLGFDDFDGSPVEMGY 257
157939672 194 KTSQVPKLLLWFNYLFGGFKNLNN-----------IN-NFHERQIVLSLPRVTLVKLHSKTLLSSIGFKQINNSPISLKF 261
9964395   301 KDIKlyKEYYNNKIIfPTNLLLCVNRLSINNLKNSSVIIIDEIHEHDRYADICIAVSYflKKVINIRNIILISATIEFEI 380
40556047  268 GGHT--E---KTKKG-FQGIVLSTNKLTSYSLSKYNIVIIDEIHEHDRIADIMIAVLR--KNIDSIHSLVLMSATLEDDK 339
41057472  266 GALT--DDERNSAPR-AYGLVMSTHRLTLNAIRRFDTVVVDEIHEHDQMGDIVVAVAR--KLAGSVRSLVLMTATLEDDR 340
41057099  265 GAIP--DAERNTAPR-TYGLVVATHRLTLTAIRRYDTVVVDEIHEHDQMGDIVVAVAR--KLGSNMRSLVLMTATLEDDR 339
9628982   271 GDLA--PADANSSRS-PFRLVVSTNQLTLGALFAHGTVILDEVHEHDQMADIMLAVLR--VHRARVDSIVLMSATLEDDR 345
9634752   269 GGKT--E---HTTRQ-HDGIVLSTNKLTSYSLSNYNIIIVDEIHEHDRIADIIISVLR--KNIDTIHSLVLMSATLEDDR 340
9633680   263 GNMQ--ERFVNTRFS-RYGIVFSTHKITLNTLFKYSTVILDEVHEHDQTGDIIIAVCR--KYIRKLDSLFLMTATLEDDR 337
9633853   263 GNMQ--EQFVNTRFR-RYGIVFSTHKITLNTLFNYSTVILDEVHEHDQTGDIIIAVCR--KYIRKLDSLFLMTATLEDDR 337
115531735 258 GNMD--PALANSRPR-RYGLVVATNKLVIGRLGQFSAVVLDEVHEHDSIADIMIAVLR--KNPGRVRALTLMTATLEDDE 332
157939672 262 GSMP--DNLINNNPK-PYGLVFSTHKLTLSKLFDYGTIIIDEVHEHDQIGDIIISVLN--KNINMFNSLFLMTATLEDDR 336
9964395   381 DNILRFFNNKIVqVYIPGFTLFPVTEI----------------ENTVDSIDKILLDNKPPVGYSVIIFYESIPKLTFIKK 444
40556047  340 DRLMEFLPDVEF-YHIEGPVLYSIKEIyvknrys--pdkrvyfDNERKNISSTLLWCKPDNGMCGILFLPSVSECIKYKE 416
41057472  341 ERLEEFLDDPAF-VHIGGGTLFAIREVyvknaqqp-plsrkyaEEELRNVTEALGTFVPDQGKCGILFVATVAQCALFAE 418
41057099  340 ARLEEFLDRPAF-VHIEGDTLFPIREVyvkntqqp-plsrkyaEAELQNVVQALGTFVPEQGKCGILFVATVAQCALFAE 417
9628982   346 ERLQEFFPDAEF-VHIPGSTRFEIRGVyvrnssdp-rdaraydEEERRNVSAALSAHRPRAGRCGILFVASVAQCEDYAR 423
9634752   341 DRLQEFLPDVEF-YHIEGPVLYSIKEIyvknkys--ydskaytEEEKKNISTTLNWCRPRNGMCGILFLASVSQCISYKK 417
9633680   338 RRIEEFFAESVF-VHIPGGTLFSISEAyvknsndp-lnrfmyiEEEKRNLANAIKTYTPPKQSSGIVFVSTVSQCEAYKQ 415
9633853   338 QRIEEFFTESVF-VHIPGGTLFSISEAyvknsnds-lnkfmyiEEEKRNLVNAIKTYTPPKQSSGIVFVSTVSQCDVYKQ 415
115531735 333 PALRAFFPKAAF-VHVEGGTLFGIKTLsvrnkhdffkqrfqylALERRLISQTLRVLRPLAGSSVVVFLASVNQCLQYAR 411
157939672 337 ERINDFFTNPLF-IHIPGGTLYNISEIyikntssf-lnkyeyiEEEKKNILNAIKKYTPLKKFSGIVFVSSVSQCEEYKK 414
9964395   445 KLEESIkdPiYKFYSIHGKTDNANEVIRYIEn-NKKHIHVIISTNYLESSITISNAKLVIDNGKVYRKEFIDGNITYITN 523
40556047  417 YLESKN--KnIDFIVIHGKLKNIAEILQDVQrpNRERPCILVSTPYLESSITIRTATHVYDTGRVYVPRPFGGEQMFISK 494
41057472  419 NISAKH--PgLLVRIVHGKIPSVADVLAEVY--AADRPAVLVSTPYLESSVTVKNATHVYDTGRVFVPEPFGGRERIVSR 494
41057099  418 TIEARH--PgLLVRVVHGKVPSVAAVLEEVY--AADRPAVLVSTPYLESSVTVRTATHVYDTGRVYVPEPFGGRETFVSK 493
9628982   424 LLTREH--PeLGVYVVHGKTPNVDALLAEVY--ASARPCVLVSTPYLESSVTIRTVTHVYDTGRVFVPAPFGGRQMLISP 499
9634752   418 YLEKSN--SdMDFIIIHGKIPDITEVLNAVQrpGRERPCILVSTPYLESSITIRTATHVYDTGRVYVPKPFGGDQLFISK 495
9633680   416 YLSERL--P-YKFYIIHGKVQNINDVLSDIY--DNDGVSIIISTPYLESSVTVRNATHVYDTGRVYIPSPYGGCESFISK 490
9633853   416 YLSERL--P-YKFYIIHGKIQNINDLLSDIY--DNEGVSIIISTPYLESSVTVQNATHVYDTGRVYIPSPYGGREVFISK 490
115531735 412 FLEPLH--PeLAFYVVHGKVPNIGALLAEIY--ASPKPAVVLSTPYLESSVTLRTAAYVYDSGRVYVAKPFGGEERFISR 487
157939672 415 YLSQKL--P-YDFYIIHGKVLNIDDMLKNIY--SSKNVSIIISTPYLESSVTIYNVTHIYDTGRVYIPAPFGGKEMFISK 489
9964395   524 SMYKQRKGRVGRVSKGTYIRTYTLDKLNTnFKNINYQYLWDYIIIFKYYGLDIKKDYFVIPDNINRVDKTVNYMKSIGID 603
40556047  495 SMMTQRKGRVGRVMKGTYVYFYDMNLLKA-IKNIDHDFLYEYIIYAKQFNLSLPEDLLIVPSNKKMLKASEEYIKSFNIP 573
41057472  495 AMYTQRRGRVGRVAPGTYVRFFDTRLAAP-IKRIDSEFLHPYVLYARVFDLKLPDDLLVRPSDPELLRRTEEYVDGFGIS 573
41057099  494 SMYTQRKGRVGRVAPGTYVRFFDTRLALP-LKRIDSEFLHPYVLYARIFGLTLPDDLLVQPSDLALLRRTEEYVDGFGIS 572
9628982   500 AMRTQRRGRVGRVMPGTYVYFYDPARLAP-IKRIDSEFLYNYIIYARHYGLVLPDDLYVQPSDLELLRRCEEYLDGFGLA 578
9634752   496 SMMTQRKGRVGRVSKGIYVYFYDMCLLKP-IKSIDHEFLYEYIVYAKKFKLSLPNDLLVIPSDKDMLKKSEEYIKSFNIS 574
9633680   491 SMRDQRKGRVGRVNPGMYVYFYNVSELRP-IKRIDFEFLHNYVLYAKVFDLQLPEDLFVKPTNVTRLHDVIEYIRSFDIS 569
9633853   491 SMRDQRKGRVGRVKPGMYIYFYDVSELRP-IKRIDFEFLHNYVLYSKVFDLQLPEDLFVKPTNMTRLRDVIEYIRSFNIS 569
115531735 488 AMMMQRKGRVGRVSPGTYVAFYDAALLAP-IKRIDYDFLHEYVIYFRHFGLALPDDLYVRPTDPGPLRRTVAYLAGFGIP 566
157939672 490 SMMEQRKGRVGRVRPGLYIYFYDVLCLKP-IKKIDFEFLHNYVLYAKYYNLTLPNDLFIIPNNLDNIKKTEEYIDSFNIP 568
9964395   604 IDKcinkIYRIFNKYEINMLEYFIIYLYGSETEKLLLSTDD-KNIIDIpyKIYNIYVKMNVKIKLESKRSI-----IYIF 677
40556047  574 FDK----LFEIYVNHFVNMVEYVKIYNKGGKKEEKLDMFER-DDILTE--ETLEDIKNLQLLVKIKTTSKRkd-lyVYTG 645
41057472  574 VCR----WTELLNRHYMHMLEYAKVYVRGGRLARALDAFER-DGVMTQ--EATEAIRAVEMLAGVVAVRRTgd-ryRAEC 645
41057099  573 LSR----WTQLLDRHYMHMVEYAKVYVRGGRLAAALDAFER-TGVMTH--EATEAIRAVDMLAVVLNVRKSkd-ryRAEC 644
9628982   579 PER----LFELASTRYLRMVEYAKIYARGGARAEELNRFER-DGVVTE--DVLASIRALNLRARVLSARARrg-qfLHTC 650
9634752   575 FDR----LFEIYVNYFVNMVEYVKIYNKGGKKAENLDMFER-NDILTG--ETLKDIKNLQLLVKINTTTRRkk-myCYKG 646
9633680   570 DDV----WTRLLSSYYIHILEYAKVYARGGSGALALDSFER-TGNLTD--DALDAIKSLNMRAKILSHKKAsahtyALRC 642
9633853   570 DGV----WTRLLSSYYIHILEYAKVYARGGQSAAALDSFER-TGNLTD--DALDAIKSLNMRAKIISHRKAsthtyALMC 642
115531735 567 DEQ----LYEIATTRFVKLVEYLRVYAAGGPVAEQLNEYERgERPLDE--PLAAALRALNLRLKVRTRTKTqt-gyAYAM 639
157939672 569 ISK----WMYILSNYYLRILEYAKIYIKGGIYSKSLDLFER-ENIINN--VVVDSIKSLNMRAKVLFFKKKnn-iyVLTC 640
9964395   678 KFINDVYDGPQKfkyintdeNVYFDK-NKIYYLKSENPLIIMRD 720
40556047  646 EILFGPYTKTII--------RLTSKR-FYKNYIYMLSDRSFTLY 680
41057472  646 KVLFGPFVGKRF--------SVVGRR-RPGKYVLMVTDRVFIES 680
41057099  645 KVLFGPFAGKKF--------VVAGRR-PPGSHVLMVTDRVFIEA 679
9628982   651 EVAFGPYAGTRF--------LLANRR-RLRGDIFMVTERSFVL- 684
9634752   647 EILFGPYMNTVI--------RLSSKQ-LYRNYVYMLTERSFTLY 681
9633680   643 KLLFGVYAGKVF--------TVYHKR-PLTGYITMIAEHSFIPD 677
9633853   643 RLLFGVYAGKTF--------IAYHKR-PLTGYITMITEHSFIPE 677
115531735 640 RVLFGPYRGAEF--------SVSHRKfVKAAYVYMIAPGVFVE- 674
157939672 641 EIMFGVYLGKKF--------NLTYRK-PLTGFILMITECNFIPE 675
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap