Conserved Protein Domain Family
PHA02652

?
PHA02652: PHA02652 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165032
View PSSM: PHA02652
Aligned: 2 rows
Threshold Bit Score: 85.7622
Threshold Setting Gi: 62637414
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956308  1 MISDIYTEGLRISNELDKLLCGDDILNMEYDAVMNIISEIKVLIDLLENMYLLDDLLFDEAELQQLSTDK 70 
62637414   1 MISDIYTEGLKISNELDKLLCGDDILNMEYDAVMNIISEIKVLIDLLENMYLLDDLLFDEAELQQLSTDK 70 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap